FE672790
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672790 vs. TrEMBL
Match: B9RFB9_RICCO (DNA binding protein, putative OS=Ricinus communis GN=RCOM_1433520 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.267e-7 Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 2 Query: 2 AMHCPHCRKIDMCRWL*ATGCRS*TEFNMDDWTRDED 112 AM CP+CRKI+ +WL A GCRS EF+MDDW DED Sbjct: 71 AMQCPNCRKIEKGQWLYANGCRSLPEFSMDDWAHDED 107
BLAST of FE672790 vs. TrEMBL
Match: B9I7H8_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_240561 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.267e-7 Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 2 Query: 2 AMHCPHCRKIDMCRWL*ATGCRS*TEFNMDDWTRDED 112 AM CP+CRKI+ +WL A GCRS EF+MDDW DED Sbjct: 61 AMQCPNCRKIEKGQWLYANGCRSLPEFSMDDWAHDED 97
BLAST of FE672790 vs. TrEMBL
Match: B9N4J3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_837174 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.266e-7 Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = 2 Query: 2 AMHCPHCRKIDMCRWL*ATGCRS*TEFNMDDWTRDED 112 AM CP+CRKI+ +WL A GCRS EF MDDW DED Sbjct: 72 AMQCPNCRKIEKGQWLYANGCRSLPEFTMDDWAHDED 108
BLAST of FE672790 vs. TAIR peptide
Match: AT3G05545.1 (| Symbols: | RING/U-box superfamily protein | chr3:1609436-1612133 FORWARD LENGTH=425) HSP 1 Score: 53.5286 bits (127), Expect = 3.134e-8 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 2 Query: 5 MHCPHCRKIDMCRWL*ATGCRS*TEFNMDDWTRDED 112 M CP+CRK++ +WL A GCRS EFN++DW +ED Sbjct: 76 MQCPNCRKVEKGQWLYANGCRSYPEFNVEDWVHEED 111 The following BLAST results are available for this feature:
BLAST of FE672790 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
BLAST of FE672790 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672790 ID=FE672790; Name=FE672790; organism=Cicer arietinum; type=EST; length=112bpback to top |