GR399017
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR399017 vs. TrEMBL
Match: D3YBA9_TRIRP (Putative uncharacterized protein OS=Trifolium repens PE=4 SV=1) HSP 1 Score: 114.39 bits (285), Expect = 3.827e-24 Identity = 55/61 (90.16%), Postives = 58/61 (95.08%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYL-NSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVFGFSPKKKYL N EHRMSGGEKR+FKSPNSVLNKARTQLLNKQR+LSEGRN GHY Sbjct: 368 EFLHDVFGFSPKKKYLGNGEHRMSGGEKRLFKSPNSVLNKARTQLLNKQRILSEGRNFGHY 428
BLAST of GR399017 vs. TrEMBL
Match: C6SUX1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 110.923 bits (276), Expect = 4.231e-23 Identity = 53/61 (86.89%), Postives = 58/61 (95.08%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNS-EHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLH+VFGFSPK+KYLN+ EHRMSGGEKRMFKSPNSVLNKARTQ LNKQR+LSEGRN GHY Sbjct: 380 EFLHEVFGFSPKRKYLNTNEHRMSGGEKRMFKSPNSVLNKARTQSLNKQRILSEGRNFGHY 440
BLAST of GR399017 vs. TrEMBL
Match: B9GNQ1_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_409936 PE=4 SV=1) HSP 1 Score: 96.6709 bits (239), Expect = 8.257e-19 Identity = 45/61 (73.77%), Postives = 54/61 (88.52%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKY-LNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVFGF+PK+K+ L EH+MS GEKRMF+SPNSVLNKARTQ LNKQR+LS+ RN GH+ Sbjct: 369 EFLHDVFGFTPKRKHILGVEHQMSSGEKRMFRSPNSVLNKARTQFLNKQRMLSKDRNVGHF 429
BLAST of GR399017 vs. TrEMBL
Match: B9R711_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1587580 PE=4 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 5.917e-17 Identity = 44/61 (72.13%), Postives = 50/61 (81.97%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNS-EHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 + LHDVFGF PKKK L EH+MS EKRMF+SPNSVLNKARTQ LNKQR+LS+ RN GH+ Sbjct: 379 ELLHDVFGFVPKKKLLQGVEHQMSSCEKRMFRSPNSVLNKARTQFLNKQRMLSKDRNVGHF 439
BLAST of GR399017 vs. TrEMBL
Match: B9IBS1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_807222 PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 2.249e-16 Identity = 40/60 (66.67%), Postives = 49/60 (81.67%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FL V GF+PK+K L EH+MS GEKRMF+SPNS+ NKARTQ LNKQR+LS+ RN GH+ Sbjct: 362 EFLQVVLGFTPKRKQLGVEHQMSSGEKRMFRSPNSIQNKARTQFLNKQRMLSKDRNVGHF 421
BLAST of GR399017 vs. TrEMBL
Match: Q9C6P0_ARATH (Putative uncharacterized protein F28L5.7 (Fragment) OS=Arabidopsis thaliana GN=F28L5.7 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.732e-12 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVF F+PKK ++S EKR+FKSPNS LNKARTQ L KQR+L++ N GHY Sbjct: 1 EFLHDVFSFTPKKI---GGGKLSNDEKRLFKSPNSALNKARTQFLAKQRMLAKNMNVGHY 57
BLAST of GR399017 vs. TrEMBL
Match: Q9ASX8_ARATH (At1g27760/T22C5_5 OS=Arabidopsis thaliana GN=At1g27760 PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.732e-12 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVF F+PKK ++S EKR+FKSPNS LNKARTQ L KQR+L++ N GHY Sbjct: 373 EFLHDVFSFTPKKI---GGGKLSNDEKRLFKSPNSALNKARTQFLAKQRMLAKNMNVGHY 429
BLAST of GR399017 vs. TrEMBL
Match: Q3ED57_ARATH (Putative uncharacterized protein At1g27760.3 OS=Arabidopsis thaliana GN=At1g27760 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.732e-12 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVF F+PKK ++S EKR+FKSPNS LNKARTQ L KQR+L++ N GHY Sbjct: 377 EFLHDVFSFTPKKI---GGGKLSNDEKRLFKSPNSALNKARTQFLAKQRMLAKNMNVGHY 433
BLAST of GR399017 vs. TrEMBL
Match: D7KBU6_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_472983 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.732e-12 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVF F+PKK ++S EKR+FKSPNS LNKARTQ L KQR+L++ N GHY Sbjct: 377 EFLHDVFSFTPKKI---GGGKLSNDEKRLFKSPNSALNKARTQFLAKQRMLAKNMNVGHY 433
BLAST of GR399017 vs. TAIR peptide
Match: AT1G27760.1 (| Symbols: SAT32, ATSAT32 | interferon-related developmental regulator family protein / IFRD protein family | chr1:9668895-9671322 FORWARD LENGTH=437) HSP 1 Score: 73.9442 bits (180), Expect = 3.925e-14 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVF F+PKK ++S EKR+FKSPNS LNKARTQ L KQR+L++ N GHY Sbjct: 373 EFLHDVFSFTPKKI---GGGKLSNDEKRLFKSPNSALNKARTQFLAKQRMLAKNMNVGHY 429
BLAST of GR399017 vs. TAIR peptide
Match: AT1G27760.2 (| Symbols: SAT32, ATSAT32 | interferon-related developmental regulator family protein / IFRD protein family | chr1:9669120-9671322 FORWARD LENGTH=426) HSP 1 Score: 73.9442 bits (180), Expect = 3.925e-14 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVF F+PKK ++S EKR+FKSPNS LNKARTQ L KQR+L++ N GHY Sbjct: 362 EFLHDVFSFTPKKI---GGGKLSNDEKRLFKSPNSALNKARTQFLAKQRMLAKNMNVGHY 418
BLAST of GR399017 vs. TAIR peptide
Match: AT1G27760.3 (| Symbols: SAT32, ATSAT32 | interferon-related developmental regulator family protein / IFRD protein family | chr1:9668895-9671322 FORWARD LENGTH=441) HSP 1 Score: 73.9442 bits (180), Expect = 3.925e-14 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = -1 Query: 259 DFLHDVFGFSPKKKYLNSEHRMSGGEKRMFKSPNSVLNKARTQLLNKQRLLSEGRNAGHY 438 +FLHDVF F+PKK ++S EKR+FKSPNS LNKARTQ L KQR+L++ N GHY Sbjct: 377 EFLHDVFSFTPKKI---GGGKLSNDEKRLFKSPNSALNKARTQFLAKQRMLAKNMNVGHY 433 The following BLAST results are available for this feature:
BLAST of GR399017 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 9
BLAST of GR399017 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR399017 ID=GR399017; Name=GR399017; organism=Cicer arietinum; type=EST; length=444bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|