DY475493
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY475493 vs. TrEMBL
Match: C6T9Y0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.319e-8 Identity = 30/36 (83.33%), Postives = 30/36 (83.33%), Query Frame = -2 Query: 147 FVQKSETLEKQCLSXAIRSYCELXVFPYEEKNPVVF 254 FVQKSE LEKQCLS AIRSYCEL V PYEEK VVF Sbjct: 281 FVQKSENLEKQCLSKAIRSYCELRVLPYEEKRTVVF 316
BLAST of DY475493 vs. TrEMBL
Match: B7FK27_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.545e-8 Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = -2 Query: 147 FVQKSETLEKQCLSXAIRSYCELXVFPYEEKNPVVF 254 FVQKSE +EKQCLS AIR YCEL V PY+EKN VVF Sbjct: 314 FVQKSENIEKQCLSMAIRFYCELRVLPYKEKNTVVF 349
BLAST of DY475493 vs. TrEMBL
Match: B7FHP0_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.116e-7 Identity = 29/36 (80.56%), Postives = 29/36 (80.56%), Query Frame = -2 Query: 147 FVQKSETLEKQCLSXAIRSYCELXVFPYEEKNPVVF 254 FVQKSE LEKQCLS AIRSYCEL V PYE K VVF Sbjct: 289 FVQKSENLEKQCLSKAIRSYCELRVLPYEIKKTVVF 324
BLAST of DY475493 vs. TAIR peptide
Match: AT5G47435.1 (| Symbols: | formyltetrahydrofolate deformylase, putative | chr5:19241779-19243424 FORWARD LENGTH=323) HSP 1 Score: 51.6026 bits (122), Expect = 1.181e-7 Identity = 24/36 (66.67%), Postives = 27/36 (75.00%), Query Frame = -2 Query: 147 FVQKSETLEKQCLSXAIRSYCELXVFPYEEKNPVVF 254 FVQKSE LEK+CL+ AI+SYCEL V PY VVF Sbjct: 288 FVQKSEDLEKKCLTRAIKSYCELRVLPYGTNKTVVF 323
BLAST of DY475493 vs. TAIR peptide
Match: AT5G47435.2 (| Symbols: | formyltetrahydrofolate deformylase, putative | chr5:19241779-19243424 FORWARD LENGTH=323) HSP 1 Score: 51.6026 bits (122), Expect = 1.181e-7 Identity = 24/36 (66.67%), Postives = 27/36 (75.00%), Query Frame = -2 Query: 147 FVQKSETLEKQCLSXAIRSYCELXVFPYEEKNPVVF 254 FVQKSE LEK+CL+ AI+SYCEL V PY VVF Sbjct: 288 FVQKSEDLEKKCLTRAIKSYCELRVLPYGTNKTVVF 323
BLAST of DY475493 vs. TAIR peptide
Match: AT4G17360.1 (| Symbols: | Formyl transferase | chr4:9703698-9705468 REVERSE LENGTH=328) HSP 1 Score: 51.2174 bits (121), Expect = 1.543e-7 Identity = 24/36 (66.67%), Postives = 27/36 (75.00%), Query Frame = -2 Query: 147 FVQKSETLEKQCLSXAIRSYCELXVFPYEEKNPVVF 254 FVQKSE LEK+CL AI+SYCEL V PY + VVF Sbjct: 293 FVQKSEDLEKKCLMKAIKSYCELRVLPYGTQRTVVF 328 The following BLAST results are available for this feature:
BLAST of DY475493 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
BLAST of DY475493 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY475493 ID=DY475493; Name=DY475493; organism=Cicer arietinum; type=EST; length=255bpback to top |