GR406888
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR406888 vs. SwissProt
Match: NU1M_PETHY (NADH-ubiquinone oxidoreductase chain 1 OS=Petunia hybrida GN=ND1 PE=3 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 1.292e-16 Identity = 38/43 (88.37%), Postives = 40/43 (93.02%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 G CT LSPGGWPPIL+LPI K+IPGSIWFSIKVILFLFLYIWV Sbjct: 241 GLCTSLSPGGWPPILDLPISKKIPGSIWFSIKVILFLFLYIWV 283
BLAST of GR406888 vs. SwissProt
Match: NU1M_OENBE (NADH-ubiquinone oxidoreductase chain 1 OS=Oenothera bertiana GN=ND1 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 9.261e-15 Identity = 36/43 (83.72%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 G CTLL GGW PIL+LPIFK+IPGSIWFSIKVI FLFLYIWV Sbjct: 247 GLCTLLFLGGWLPILDLPIFKKIPGSIWFSIKVIFFLFLYIWV 289
BLAST of GR406888 vs. SwissProt
Match: NU1M_ARATH (NADH-ubiquinone oxidoreductase chain 1 OS=Arabidopsis thaliana GN=ND1 PE=1 SV=4) HSP 1 Score: 76.6406 bits (187), Expect = 4.596e-14 Identity = 34/43 (79.07%), Postives = 37/43 (86.05%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 G CTL GGW PIL+LPIFK+IPGSIWFSIKV+ FLFLYIWV Sbjct: 241 GLCTLFFLGGWLPILDLPIFKKIPGSIWFSIKVLFFLFLYIWV 283
BLAST of GR406888 vs. SwissProt
Match: NU1M_WHEAT (NADH-ubiquinone oxidoreductase chain 1 OS=Triticum aestivum GN=ND1 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 5.082e-13 Identity = 34/43 (79.07%), Postives = 37/43 (86.05%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 G CTLL GGW PIL+LPI K+IP SIWFSIKV+LFLFLYIWV Sbjct: 241 GLCTLLFLGGWLPILDLPISKKIPCSIWFSIKVLLFLFLYIWV 283
BLAST of GR406888 vs. SwissProt
Match: NU1M_MARPO (NADH-ubiquinone oxidoreductase chain 1 OS=Marchantia polymorpha GN=ND1 PE=3 SV=2) HSP 1 Score: 71.633 bits (174), Expect = 1.479e-12 Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 310 CTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 CTLL GGW PIL++PIF+ IPGSIWFSIKV+ FLF+YIWV Sbjct: 246 CTLLFLGGWLPILDIPIFQVIPGSIWFSIKVLFFLFVYIWV 286
BLAST of GR406888 vs. TrEMBL
Match: A5BTM4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_042143 PE=4 SV=1) HSP 1 Score: 105.531 bits (262), Expect = 1.763e-21 Identity = 53/73 (72.60%), Postives = 53/73 (72.60%), Query Frame = -2 Query: 141 MGRFRIGGQPPGESNVHGPGE*GCSSVDRLSGLIGGGFTPFSKEPYVRLSRHTAPSRKKDPPFPLTNGSSNQP 359 MGR RIGGQPPGESNVHGPG GG TPFSKEPYV LSRHTAPSR KD PFPLTNGSSNQP Sbjct: 1 MGRSRIGGQPPGESNVHGPG---------------GGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSNQP 58
BLAST of GR406888 vs. TrEMBL
Match: B9T901_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_2104750 PE=4 SV=1) HSP 1 Score: 101.293 bits (251), Expect = 3.310e-20 Identity = 46/53 (86.79%), Postives = 48/53 (90.57%), Query Frame = -1 Query: 136 MQLRGPLVGPDRWWFHTLFKGTVRETLASYGSVPEEG-PPLSFDQRVLEPTFP 291 MQLRGPLVGPDRWW+HTL KGTVR+TLASYGS PE G PP SFDQRVLEPTFP Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEPTFP 53
BLAST of GR406888 vs. TrEMBL
Match: Q37475_SOYBN (NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Glycine max GN=nad1 PE=3 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 9.015e-18 Identity = 41/43 (95.35%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCT LSPGGWPPIL+LPIFKRIPGSIWFSIKVILFLFLYIWV Sbjct: 21 GPCTSLSPGGWPPILDLPIFKRIPGSIWFSIKVILFLFLYIWV 63
BLAST of GR406888 vs. TrEMBL
Match: Q37693_VICFA (NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Vicia faba GN=nad1 PE=3 SV=2) HSP 1 Score: 92.4337 bits (228), Expect = 1.538e-17 Identity = 40/43 (93.02%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCTLLSPGGWPPIL+LPI KRIPGSIWFSIKVI+FLFLYIWV Sbjct: 22 GPCTLLSPGGWPPILDLPILKRIPGSIWFSIKVIMFLFLYIWV 64
BLAST of GR406888 vs. TrEMBL
Match: B9U3K2_CARPA (NADH-ubiquinone oxidoreductase chain 1 OS=Carica papaya GN=nad1 PE=3 SV=2) HSP 1 Score: 91.6633 bits (226), Expect = 2.623e-17 Identity = 40/43 (93.02%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCTLLSPGGWPPIL+LPIFK+IPGSIWFSIKVILF FLYIWV Sbjct: 241 GPCTLLSPGGWPPILDLPIFKKIPGSIWFSIKVILFPFLYIWV 283
BLAST of GR406888 vs. TrEMBL
Match: Q2V2T4_ARATH (NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Arabidopsis thaliana GN=nad1 PE=3 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 9.967e-17 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCTL PGGWPPIL+LPIFK+IPGSIWFSIKV+LFLFLYIWV Sbjct: 241 GPCTLFFPGGWPPILDLPIFKKIPGSIWFSIKVLLFLFLYIWV 283
BLAST of GR406888 vs. TrEMBL
Match: A7KNG7_ARATH (NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Arabidopsis thaliana PE=2 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 9.967e-17 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCTL PGGWPPIL+LPIFK+IPGSIWFSIKV+LFLFLYIWV Sbjct: 220 GPCTLFFPGGWPPILDLPIFKKIPGSIWFSIKVLLFLFLYIWV 262
BLAST of GR406888 vs. TrEMBL
Match: Q37565_OENBE (NADH-ubiquinone oxidoreductase chain 1 OS=Oenothera bertiana GN=nad1 PE=3 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 2.900e-16 Identity = 39/43 (90.70%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 G CT LSPGGWPPIL+LPIFK+IPGSIWFSIKVILFLFLYIWV Sbjct: 247 GLCTSLSPGGWPPILDLPIFKKIPGSIWFSIKVILFLFLYIWV 289
BLAST of GR406888 vs. TrEMBL
Match: Q5U6E2_BETVU (NADH-ubiquinone oxidoreductase chain 1 OS=Beta vulgaris subsp. vulgaris GN=nad1 PE=3 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 1.102e-15 Identity = 39/43 (90.70%), Postives = 40/43 (93.02%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 G CT LSPGGWPPIL+LPI KRIPGSIWFSIKVILFLFLYIWV Sbjct: 241 GLCTSLSPGGWPPILDLPISKRIPGSIWFSIKVILFLFLYIWV 283
BLAST of GR406888 vs. TrEMBL
Match: Q9XJZ1_SOLTU (NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Solanum tuberosum GN=nad1 PE=3 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 2.455e-15 Identity = 38/43 (88.37%), Postives = 40/43 (93.02%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 G CT LSPGGWPPIL+LPI K+IPGSIWFSIKVILFLFLYIWV Sbjct: 1 GLCTSLSPGGWPPILDLPISKKIPGSIWFSIKVILFLFLYIWV 43
BLAST of GR406888 vs. TAIR peptide
Match: ATMG01275.1 (| Symbols: NAD1A, NAD1, ND1 | NADH dehydrogenase 1A | chrM:318004-318390 REVERSE LENGTH=325) HSP 1 Score: 89.7373 bits (221), Expect = 6.428e-19 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCTL PGGWPPIL+LPIFK+IPGSIWFSIKV+LFLFLYIWV Sbjct: 241 GPCTLFFPGGWPPILDLPIFKKIPGSIWFSIKVLLFLFLYIWV 283
BLAST of GR406888 vs. TAIR peptide
Match: ATMG00516.1 (| Symbols: NAD1C, NAD1 | NADH dehydrogenase 1C | chrM:143219-147048 REVERSE LENGTH=325) HSP 1 Score: 89.7373 bits (221), Expect = 6.428e-19 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCTL PGGWPPIL+LPIFK+IPGSIWFSIKV+LFLFLYIWV Sbjct: 241 GPCTLFFPGGWPPILDLPIFKKIPGSIWFSIKVLLFLFLYIWV 283
BLAST of GR406888 vs. TAIR peptide
Match: ATMG01120.1 (| Symbols: NAD1B, NAD1 | NADH dehydrogenase 1B | chrM:287917-289083 REVERSE LENGTH=325) HSP 1 Score: 89.7373 bits (221), Expect = 6.428e-19 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 304 GPCTLLSPGGWPPILNLPIFKRIPGSIWFSIKVILFLFLYIWV 432 GPCTL PGGWPPIL+LPIFK+IPGSIWFSIKV+LFLFLYIWV Sbjct: 241 GPCTLFFPGGWPPILDLPIFKKIPGSIWFSIKVLLFLFLYIWV 283 The following BLAST results are available for this feature:
BLAST of GR406888 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 5
BLAST of GR406888 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR406888 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR406888 ID=GR406888; Name=GR406888; organism=Cicer arietinum; type=EST; length=432bpback to top |