GR913621
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR913621 vs. TrEMBL
Match: Q5GQ66_PEA (Alpha-dioxygenase OS=Pisum sativum GN=alphaDOX1 PE=2 SV=1) HSP 1 Score: 102.064 bits (253), Expect = 1.967e-20 Identity = 51/65 (78.46%), Postives = 57/65 (87.69%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GSV+YGSNE+VL KVRT KDGKLKISK+G+L N DGT ISGDIR+SWAGVTTLQTLFVQ Sbjct: 221 TPWWDGSVVYGSNEQVLNKVRTFKDGKLKISKEGHLLHNEDGTAISGDIRNSWAGVTTLQTLFVQ 285
BLAST of GR913621 vs. TrEMBL
Match: Q69EZ9_SOLLC (Alpha-DOX2 OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 8.551e-16 Identity = 43/67 (64.18%), Postives = 52/67 (77.61%), Query Frame = 1 Query: 19 RGTPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 R TP+ GSVIYGSN E+LKKVRT KDGKLK+S+ G L + +G ISGD+R++WAG TLQ LFVQ Sbjct: 217 RRTPWWDGSVIYGSNVEILKKVRTFKDGKLKLSENGLLEQDENGKIISGDVRNTWAGFVTLQALFVQ 283
BLAST of GR913621 vs. TrEMBL
Match: O82031_TOBAC (Oxygenase (Fragment) OS=Nicotiana tabacum GN=piox PE=2 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 3.249e-15 Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GS IYGSN EVLKKVRT KDGKLK+S G L ++ +G ISGD+R++WAG++ LQ LFVQ Sbjct: 220 TPWWDGSAIYGSNAEVLKKVRTFKDGKLKLSADGLLEIDKNGKIISGDVRNTWAGLSALQALFVQ 284
BLAST of GR913621 vs. TrEMBL
Match: Q69F00_SOLLC (Alpha-DOX1 OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 4.244e-15 Identity = 40/65 (61.54%), Postives = 52/65 (80.00%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GSVIYGSNE+VLKKVRT +DGKLK+ + G + + +G ISGD+R++WAG+ TLQ LFVQ Sbjct: 218 TPWWDGSVIYGSNEDVLKKVRTFRDGKLKLGENGLIQQDENGKIISGDVRNTWAGLLTLQALFVQ 282
BLAST of GR913621 vs. TrEMBL
Match: Q9AXU5_9SOLA (Pathogen-inducible alpha-dioxygenase OS=Nicotiana attenuata GN=PIOX_NICAT PE=2 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 1.613e-14 Identity = 41/67 (61.19%), Postives = 51/67 (76.12%), Query Frame = 1 Query: 19 RGTPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 R TP+ GS IYGSN EVLKKVRT K GKLK+S G L ++ +G ISGD+R++WAG++ LQ LFVQ Sbjct: 218 RRTPWWDGSAIYGSNAEVLKKVRTFKYGKLKLSADGLLEIDENGKIISGDVRNTWAGLSALQALFVQ 284
BLAST of GR913621 vs. TrEMBL
Match: B9HIP7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_820569 PE=4 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 3.593e-14 Identity = 41/65 (63.08%), Postives = 50/65 (76.92%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GS IYGSNE+ L KVRT KDGKLKIS+ G L + DG +SGD+R+SWAGV+ LQ LFV+ Sbjct: 220 TPWWDGSAIYGSNEKRLHKVRTFKDGKLKISEDGLLLHDQDGIAVSGDVRNSWAGVSILQALFVK 284
BLAST of GR913621 vs. TrEMBL
Match: A9PFX6_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 3.593e-14 Identity = 41/65 (63.08%), Postives = 50/65 (76.92%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GS IYGSNE+ L KVRT KDGKLKIS+ G L + DG +SGD+R+SWAGV+ LQ LFV+ Sbjct: 190 TPWWDGSAIYGSNEKRLHKVRTFKDGKLKISEDGLLLHDQDGIAVSGDVRNSWAGVSILQALFVK 254
BLAST of GR913621 vs. TrEMBL
Match: B9RUF7_RICCO (Oxidoreductase, putative OS=Ricinus communis GN=RCOM_0852500 PE=4 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 6.128e-14 Identity = 40/65 (61.54%), Postives = 49/65 (75.38%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GS IYGSN E L KVRT KDGKLKISK G L + +G +SGD+R+SW GV+TLQ LF++ Sbjct: 195 TPWWDGSAIYGSNSEWLHKVRTFKDGKLKISKDGLLLHDPNGIAVSGDVRNSWIGVSTLQALFIK 259
BLAST of GR913621 vs. TrEMBL
Match: Q93X71_CAPAN (Cyclooxygenase-like protein OS=Capsicum annuum PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.045e-13 Identity = 39/67 (58.21%), Postives = 48/67 (71.64%), Query Frame = 1 Query: 19 RGTPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 R TP+ GS IYGSN E LKKVRT +DGKLK+S G L + +G ISGD+R+ WAG+ LQ LF+Q Sbjct: 218 RRTPWWDGSAIYGSNTEALKKVRTFEDGKLKLSADGLLEQDENGNIISGDVRNPWAGLLALQALFIQ 284
BLAST of GR913621 vs. TrEMBL
Match: D7TWT2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_66.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00032513001 PE=4 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.045e-13 Identity = 40/65 (61.54%), Postives = 51/65 (78.46%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GS IYGSNE+ L++VRT KDGKLKIS+ G L + D +SGD+R+SWAGV+TLQ LFV+ Sbjct: 216 TPWWDGSAIYGSNEKQLQRVRTFKDGKLKISEDGLLLHDQDMIPVSGDVRNSWAGVSTLQALFVK 280
BLAST of GR913621 vs. TAIR peptide
Match: AT3G01420.1 (| Symbols: ALPHA-DOX1, DOX1, DIOX1, PADOX-1 | Peroxidase superfamily protein | chr3:159689-162726 REVERSE LENGTH=639) HSP 1 Score: 76.2554 bits (186), Expect = 4.447e-15 Identity = 40/66 (60.61%), Postives = 50/66 (75.76%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHL-N*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ SVIYGSN + L +VRT KDGKLKIS++ L L + DG ISGDIR+SWAGV+ LQ LF++ Sbjct: 216 TPWWDSSVIYGSNSKTLDRVRTYKDGKLKISEETGLLLHDEDGLAISGDIRNSWAGVSALQALFIK 281
BLAST of GR913621 vs. TAIR peptide
Match: AT1G73680.2 (| Symbols: ALPHA DOX2 | alpha dioxygenase | chr1:27704221-27707417 REVERSE LENGTH=640) HSP 1 Score: 71.2478 bits (173), Expect = 1.430e-13 Identity = 36/65 (55.38%), Postives = 47/65 (72.31%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GSVIYG++E +++VR KDGKLKIS G L + G ISGDIR+SW+G + LQ LFV+ Sbjct: 218 TPWWDGSVIYGNDETGMRRVRVFKDGKLKISGDGLLERDERGVPISGDIRNSWSGFSLLQALFVK 282
BLAST of GR913621 vs. TAIR peptide
Match: AT1G73680.1 (| Symbols: ALPHA DOX2 | alpha dioxygenase | chr1:27704221-27707417 REVERSE LENGTH=631) HSP 1 Score: 71.2478 bits (173), Expect = 1.430e-13 Identity = 36/65 (55.38%), Postives = 47/65 (72.31%), Query Frame = 1 Query: 25 TPFSHGSVIYGSNEEVLKKVRTCKDGKLKISKQGNLHLN*DGTTISGDIRSSWAGVTTLQTLFVQ 219 TP+ GSVIYG++E +++VR KDGKLKIS G L + G ISGDIR+SW+G + LQ LFV+ Sbjct: 209 TPWWDGSVIYGNDETGMRRVRVFKDGKLKISGDGLLERDERGVPISGDIRNSWSGFSLLQALFVK 273 The following BLAST results are available for this feature:
BLAST of GR913621 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR913621 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR913621 ID=GR913621; Name=GR913621; organism=Cicer arietinum; type=EST; length=221bpback to top |