CK148879
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK148879 vs. SwissProt
Match: U202B_ARATH (UPF0202 protein At3g57940 OS=Arabidopsis thaliana GN=At3g57940 PE=2 SV=2) HSP 1 Score: 80.8777 bits (198), Expect = 4.480e-15 Identity = 41/55 (74.55%), Postives = 46/55 (83.64%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGT 251 AAIPLP+VK LLG YLVFLSST +GYEGTGRSLSLKL+QQL +QSR A EG+ Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLDEQSRAPATGLEGS 444
BLAST of CK148879 vs. SwissProt
Match: NAT10_MOUSE (N-acetyltransferase 10 OS=Mus musculus GN=Nat10 PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 3.792e-14 Identity = 41/62 (66.13%), Postives = 47/62 (75.81%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTVKQRCSA 272 AAIPLP+VK LLG YLVF++ST NGYEGTGRSLSLKL+QQL+ QS S ST K +A Sbjct: 391 AAIPLPLVKSLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSAQSQVSTTAENKTTTTA 452
BLAST of CK148879 vs. SwissProt
Match: NAT10_HUMAN (N-acetyltransferase 10 OS=Homo sapiens GN=NAT10 PE=1 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 3.792e-14 Identity = 41/62 (66.13%), Postives = 47/62 (75.81%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTVKQRCSA 272 AAIPLP+VK LLG YLVF++ST NGYEGTGRSLSLKL+QQL+ QS S ST K +A Sbjct: 391 AAIPLPLVKSLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSAQSQVSTTAENKTTTTA 452
BLAST of CK148879 vs. SwissProt
Match: NAT10_DICDI (N-acetyltransferase 10 homolog OS=Dictyostelium discoideum GN=nat10 PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 4.953e-14 Identity = 37/52 (71.15%), Postives = 46/52 (88.46%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKST 242 AAIPLP+VK LLG YLVF+SST NGYEGTGRSLSLKL++QL++QS + + S+ Sbjct: 388 AAIPLPLVKNLLGPYLVFMSSTINGYEGTGRSLSLKLIKQLREQSTVVSNSS 439
BLAST of CK148879 vs. SwissProt
Match: KRE33_YEAST (UPF0202 protein KRE33 OS=Saccharomyces cerevisiae GN=KRE33 PE=1 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 6.469e-14 Identity = 40/60 (66.67%), Postives = 49/60 (81.67%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAK-STEGTVKQR 263 AAIPLP+VK LLG YLVF++ST NGYEGTGRSLSLKL+QQL++Q+ S + ST+ V R Sbjct: 390 AAIPLPIVKNLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRNQNNTSGRESTQTAVVSR 449
BLAST of CK148879 vs. SwissProt
Match: YDK9_SCHPO (UPF0202 protein C20G8.09c OS=Schizosaccharomyces pombe GN=SPAC20G8.09c PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.449e-14 Identity = 37/51 (72.55%), Postives = 46/51 (90.20%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKS 239 AAIPLP+V+ L+G YLVF++ST NGYEGTGRSLSLKL+QQL++QSRI + S Sbjct: 389 AAIPLPLVRKLIGPYLVFMASTINGYEGTGRSLSLKLLQQLREQSRIYSGS 439
BLAST of CK148879 vs. SwissProt
Match: U202_DROME (Polycomb protein l(1)G0020 OS=Drosophila melanogaster GN=l(1)G0020 PE=1 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 1.349e-11 Identity = 32/42 (76.19%), Postives = 38/42 (90.48%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQ 212 AAIPLP+VK ++G YLVF++ST NGYEGTGRSLSLKL+ QLQ Sbjct: 386 AAIPLPLVKKMIGPYLVFMASTINGYEGTGRSLSLKLISQLQ 427
BLAST of CK148879 vs. SwissProt
Match: U202A_ARATH (UPF0202 protein At1g10490 OS=Arabidopsis thaliana GN=At1g10490 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.301e-11 Identity = 40/77 (51.95%), Postives = 47/77 (61.04%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANG---------------------YEGTGRSLSLKLVQQLQDQSRISAKSTEGTV 254 AAIPLP+VK LLG YLVFLSST +G YEGTGRSLSLKL+QQL++QSR EG++ Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVSGYVKQEVSQAADFCLFYLLCQSYEGTGRSLSLKLLQQLEEQSRAPVTGVEGSL 466
BLAST of CK148879 vs. SwissProt
Match: YIL8_CAEEL (UPF0202 protein F55A12.8 OS=Caenorhabditis elegans GN=F55A12.8 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.126e-11 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 87 AAIPLPMVKYLL-GQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQS 221 AAIPLP+VK L+ G Y+ FLSST NGYEGTGRSLSLKL+QQL+ QS Sbjct: 389 AAIPLPLVKELISGPYISFLSSTINGYEGTGRSLSLKLLQQLRQQS 434
BLAST of CK148879 vs. TrEMBL
Match: B9HG40_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1082743 PE=4 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 3.748e-16 Identity = 43/59 (72.88%), Postives = 53/59 (89.83%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTVKQR 263 AAIPLP+V+ LLG YLVFLSST NGYEGTGRSLSLKL+QQL++QS+IS+K+ EG++ R Sbjct: 389 AAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLQQLEEQSQISSKNVEGSLSGR 447
BLAST of CK148879 vs. TrEMBL
Match: B9H5L1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_863270 PE=4 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 3.748e-16 Identity = 43/59 (72.88%), Postives = 53/59 (89.83%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTVKQR 263 AAIPLP+V+ LLG YLVFLSST NGYEGTGRSLSLKL+QQL++QS+IS+K+ EG++ R Sbjct: 395 AAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLQQLEEQSQISSKNVEGSLSGR 453
BLAST of CK148879 vs. TrEMBL
Match: D7SW77_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_31.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00022250001 PE=4 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 4.144e-15 Identity = 42/59 (71.19%), Postives = 50/59 (84.75%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTVKQR 263 AAIPLP+VK LLG YLVFLSST NGYEGTGRSLSLKL+QQL++QS++ KS E ++ R Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVNGYEGTGRSLSLKLLQQLEEQSQMPTKSVENSLSGR 448
BLAST of CK148879 vs. TrEMBL
Match: C6HAG2_AJECH (Nucleolar ATPase Kre33 OS=Ajellomyces capsulata (strain H143) GN=HCDG_03193 PE=4 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 2.057e-14 Identity = 40/55 (72.73%), Postives = 48/55 (87.27%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGT 251 AAIPLPMV+ L+G YLVF++ST NGYEGTGRSLSLKL+QQL++QSR AKS + T Sbjct: 383 AAIPLPMVRKLMGPYLVFMASTINGYEGTGRSLSLKLIQQLREQSRGGAKSADDT 437
BLAST of CK148879 vs. TrEMBL
Match: C0NC57_AJECG (Killer toxin resistant protein OS=Ajellomyces capsulata (strain ATCC 26029 / G186AR / H82 / RMSCC 2432) GN=HCBG_00703 PE=4 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 2.057e-14 Identity = 40/55 (72.73%), Postives = 48/55 (87.27%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGT 251 AAIPLPMV+ L+G YLVF++ST NGYEGTGRSLSLKL+QQL++QSR AKS + T Sbjct: 392 AAIPLPMVRKLMGPYLVFMASTINGYEGTGRSLSLKLIQQLREQSRGGAKSADDT 446
BLAST of CK148879 vs. TrEMBL
Match: A6R595_AJECN (Putative uncharacterized protein OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=HCAG_04803 PE=4 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 2.057e-14 Identity = 40/55 (72.73%), Postives = 48/55 (87.27%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGT 251 AAIPLPMV+ L+G YLVF++ST NGYEGTGRSLSLKL+QQL++QSR AKS + T Sbjct: 392 AAIPLPMVRKLMGPYLVFMASTINGYEGTGRSLSLKLIQQLREQSRGGAKSADDT 446
BLAST of CK148879 vs. TrEMBL
Match: D7LVY2_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_486246 PE=4 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 4.582e-14 Identity = 41/56 (73.21%), Postives = 47/56 (83.93%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTV 254 AAIPLP+VK LLG YLVFLSST +GYEGTGRSLSLKL+QQL +QSR A EG++ Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLDEQSRAPATGLEGSL 445
BLAST of CK148879 vs. TrEMBL
Match: Q0WVY1_ARATH (Putative uncharacterized protein At1g10490 OS=Arabidopsis thaliana GN=At1g10490 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 5.984e-14 Identity = 40/56 (71.43%), Postives = 47/56 (83.93%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTV 254 AAIPLP+VK LLG YLVFLSST +GYEGTGRSLSLKL+QQL++QSR EG++ Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLEEQSRAPVTGVEGSL 445
BLAST of CK148879 vs. TrEMBL
Match: C5GCY7_AJEDR (Nucleolar ATPase Kre33 OS=Ajellomyces dermatitidis (strain ER-3) GN=BDCG_01483 PE=4 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 7.816e-14 Identity = 39/55 (70.91%), Postives = 48/55 (87.27%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGT 251 AAIPLP+V+ L+G YLVF++ST NGYEGTGRSLSLKL+QQL++QSR AKS + T Sbjct: 392 AAIPLPLVRKLMGPYLVFMASTINGYEGTGRSLSLKLIQQLREQSRGGAKSGDDT 446
BLAST of CK148879 vs. TrEMBL
Match: C5DCS9_LACTC (KLTH0B05522p OS=Lachancea thermotolerans (strain CBS 6340) GN=KLTH0B05522g PE=4 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 7.816e-14 Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTV 254 AAIPLP+VK LLG YLVF++ST NGYEGTGRSLSLKL+QQL+DQ+ S + T T+ Sbjct: 390 AAIPLPVVKNLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRDQANSSGRETSETM 445
BLAST of CK148879 vs. TAIR peptide
Match: AT3G57940.2 (| Symbols: | Domain of unknown function (DUF1726) ;Putative ATPase (DUF699) | chr3:21449560-21455834 FORWARD LENGTH=1023) HSP 1 Score: 80.8777 bits (198), Expect = 4.855e-16 Identity = 41/55 (74.55%), Postives = 46/55 (83.64%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGT 251 AAIPLP+VK LLG YLVFLSST +GYEGTGRSLSLKL+QQL +QSR A EG+ Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLDEQSRAPATGLEGS 444
BLAST of CK148879 vs. TAIR peptide
Match: AT3G57940.1 (| Symbols: | Domain of unknown function (DUF1726) ;Putative ATPase (DUF699) | chr3:21449560-21455834 FORWARD LENGTH=1028) HSP 1 Score: 80.8777 bits (198), Expect = 4.855e-16 Identity = 41/55 (74.55%), Postives = 46/55 (83.64%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGT 251 AAIPLP+VK LLG YLVFLSST +GYEGTGRSLSLKL+QQL +QSR A EG+ Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLDEQSRAPATGLEGS 444
BLAST of CK148879 vs. TAIR peptide
Match: AT1G10490.1 (| Symbols: | Domain of unknown function (DUF1726) ;Putative ATPase (DUF699) | chr1:3453589-3459925 FORWARD LENGTH=1028) HSP 1 Score: 80.8777 bits (198), Expect = 4.855e-16 Identity = 40/56 (71.43%), Postives = 47/56 (83.93%), Query Frame = 3 Query: 87 AAIPLPMVKYLLGQYLVFLSSTANGYEGTGRSLSLKLVQQLQDQSRISAKSTEGTV 254 AAIPLP+VK LLG YLVFLSST +GYEGTGRSLSLKL+QQL++QSR EG++ Sbjct: 390 AAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLEEQSRAPVTGVEGSL 445 The following BLAST results are available for this feature:
BLAST of CK148879 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 9
BLAST of CK148879 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of CK148879 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK148879 ID=CK148879; Name=CK148879; organism=Cicer arietinum; type=EST; length=546bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|