GR916874
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR916874 vs. TAIR peptide
Match: AT1G53380.3 (| Symbols: | Plant protein of unknown function (DUF641) | chr1:19913341-19914702 REVERSE LENGTH=453) HSP 1 Score: 50.447 bits (119), Expect = 4.648e-7 Identity = 24/46 (52.17%), Postives = 29/46 (63.04%), Query Frame = 2 Query: 26 YMESVNDEEMFQXXXXXXXXXQHVGFTVVPGFRIGKTVLQCQVYLT 163 YM+SV +E F V FTVVPGFRIGKT +QC+VYL+ Sbjct: 406 YMKSVAEEAFFPAAESSPESEPRVAFTVVPGFRIGKTSIQCEVYLS 451
BLAST of GR916874 vs. TAIR peptide
Match: AT1G53380.2 (| Symbols: | Plant protein of unknown function (DUF641) | chr1:19913341-19914702 REVERSE LENGTH=453) HSP 1 Score: 50.447 bits (119), Expect = 4.648e-7 Identity = 24/46 (52.17%), Postives = 29/46 (63.04%), Query Frame = 2 Query: 26 YMESVNDEEMFQXXXXXXXXXQHVGFTVVPGFRIGKTVLQCQVYLT 163 YM+SV +E F V FTVVPGFRIGKT +QC+VYL+ Sbjct: 406 YMKSVAEEAFFPAAESSPESEPRVAFTVVPGFRIGKTSIQCEVYLS 451
BLAST of GR916874 vs. TAIR peptide
Match: AT1G53380.1 (| Symbols: | Plant protein of unknown function (DUF641) | chr1:19913341-19914702 REVERSE LENGTH=453) HSP 1 Score: 50.447 bits (119), Expect = 4.648e-7 Identity = 24/46 (52.17%), Postives = 29/46 (63.04%), Query Frame = 2 Query: 26 YMESVNDEEMFQXXXXXXXXXQHVGFTVVPGFRIGKTVLQCQVYLT 163 YM+SV +E F V FTVVPGFRIGKT +QC+VYL+ Sbjct: 406 YMKSVAEEAFFPAAESSPESEPRVAFTVVPGFRIGKTSIQCEVYLS 451 The following BLAST results are available for this feature:
BLAST of GR916874 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR916874 ID=GR916874; Name=GR916874; organism=Cicer arietinum; type=EST; length=447bpback to top |