HO066318
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO066318 vs. SwissProt
Match: CYC6_ARATH (Cytochrome c6, chloroplastic OS=Arabidopsis thaliana GN=petJ PE=1 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 7.014e-9 Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 293 GQCTFGARLEDEEIKILAEFVKLQADKGWP 382 GQCTFG RL+DEEIK+LAEFVK QAD+GWP Sbjct: 141 GQCTFGPRLQDEEIKLLAEFVKFQADQGWP 170
BLAST of HO066318 vs. TrEMBL
Match: A2Q293_MEDTR (Cytochrome c, monohaem OS=Medicago truncatula GN=MtrDRAFT_AC149576g7v2 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.168e-9 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = -2 Query: 278 GQCTFGARLEDEEIKILAEFVKLQADKGWPRDESK 382 GQCTFGARLEDE+IKILAEFVKLQADKGWP E++ Sbjct: 137 GQCTFGARLEDEDIKILAEFVKLQADKGWPSIETE 171
BLAST of HO066318 vs. TrEMBL
Match: D7T9J4_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00012076001 PE=4 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 9.890e-9 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = -2 Query: 275 GQCTFGARLEDEEIKILAEFVKLQADKGWPRDESKG 382 GQCTFGARL++EEIK+LAEFVKLQAD+GWP E G Sbjct: 137 GQCTFGARLQEEEIKLLAEFVKLQADQGWPNLEISG 172
BLAST of HO066318 vs. TrEMBL
Match: A5BPG9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_008455 PE=4 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 9.890e-9 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = -2 Query: 275 GQCTFGARLEDEEIKILAEFVKLQADKGWPRDESKG 382 GQCTFGARL++EEIK+LAEFVKLQAD+GWP E G Sbjct: 89 GQCTFGARLQEEEIKLLAEFVKLQADQGWPNLEISG 124
BLAST of HO066318 vs. TrEMBL
Match: D7MKY9_ARALY (Cytochrome c6 OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_917055 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.908e-8 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 293 GQCTFGARLEDEEIKILAEFVKLQADKGWP 382 GQCTFG RL+DEEIK+LAEFVK QADKGWP Sbjct: 142 GQCTFGPRLQDEEIKLLAEFVKFQADKGWP 171
BLAST of HO066318 vs. TrEMBL
Match: D7MKW8_ARALY (Electron transporter protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_330891 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.908e-8 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 293 GQCTFGARLEDEEIKILAEFVKLQADKGWP 382 GQCTFG RL+DEEIK+LAEFVK QADKGWP Sbjct: 142 GQCTFGPRLQDEEIKLLAEFVKFQADKGWP 171
BLAST of HO066318 vs. TrEMBL
Match: A0MZP9_BRACM (Electron transporter protein OS=Brassica campestris PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.436e-7 Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 293 GQCTFGARLEDEEIKILAEFVKLQADKGWP 382 GQCTFG RL+DEEIK+L+EFVKLQAD GWP Sbjct: 140 GQCTFGPRLQDEEIKLLSEFVKLQADLGWP 169
BLAST of HO066318 vs. TrEMBL
Match: B9NDA1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_937595 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.181e-7 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 284 GQCTFGARLEDEEIKILAEFVKLQADKGWPRDE 382 GQCTFG RL+DEEIK+LA+FVK QAD+GWP E Sbjct: 123 GQCTFGPRLQDEEIKLLAQFVKSQADQGWPNIE 155
BLAST of HO066318 vs. TrEMBL
Match: B9ICN4_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_901632 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.181e-7 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 284 GQCTFGARLEDEEIKILAEFVKLQADKGWPRDE 382 GQCTFG RL+DEEIK+LA+FVK QAD+GWP E Sbjct: 74 GQCTFGPRLQDEEIKLLAQFVKSQADQGWPNIE 106
BLAST of HO066318 vs. TrEMBL
Match: A9NNY8_PICSI (Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.257e-7 Identity = 24/33 (72.73%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 284 GQCTFGARLEDEEIKILAEFVKLQADKGWPRDE 382 GQCTFG RL DE+I +LAE+VKLQAD+GWP+ E Sbjct: 158 GQCTFGPRLSDEDIHLLAEYVKLQADQGWPKLE 190
BLAST of HO066318 vs. TAIR peptide
Match: AT5G45040.1 (| Symbols: | Cytochrome c | chr5:18175566-18176851 REVERSE LENGTH=175) HSP 1 Score: 59.3066 bits (142), Expect = 7.595e-10 Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = -2 Query: 293 GQCTFGARLEDEEIKILAEFVKLQADKGWP 382 GQCTFG RL+DEEIK+LAEFVK QAD+GWP Sbjct: 141 GQCTFGPRLQDEEIKLLAEFVKFQADQGWP 170 The following BLAST results are available for this feature:
BLAST of HO066318 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of HO066318 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 9
BLAST of HO066318 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO066318 ID=HO066318; Name=HO066318; organism=Cicer arietinum; type=EST; length=398bpback to top |