GR914677
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR914677 vs. TrEMBL
Match: A7UQS8_MEDTR (Metal ion transporter , putative OS=Medicago truncatula GN=MtrDRAFT_AC148396g29v2 PE=4 SV=1) HSP 1 Score: 104.375 bits (259), Expect = 3.871e-21 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 2 Query: 23 VLLCFLFPALYTRIVVVWREKRTLGRNWSLNRKSLLRRPLRIEDTARGGYLRI 181 VLLCFLFPALYTRIV WREK+TLGRNWSLN+KSLLRRPLRI+DTARGGYLRI Sbjct: 414 VLLCFLFPALYTRIVTAWREKKTLGRNWSLNKKSLLRRPLRIDDTARGGYLRI 466
BLAST of GR914677 vs. TrEMBL
Match: B9HN75_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_821328 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.439e-9 Identity = 31/53 (58.49%), Postives = 40/53 (75.47%), Query Frame = 2 Query: 23 VLLCFLFPALYTRIVVVWREKRTLGRNWSLNRKSLLRRPLRIEDTARGGYLRI 181 VLLCFLFPALYT I WR + L R+WSLNRKS L+R + +++ RGGY+R+ Sbjct: 461 VLLCFLFPALYTHIAA-WRRRMALKRSWSLNRKSFLKRTVPVKE--RGGYIRL 510
BLAST of GR914677 vs. TrEMBL
Match: B9GJ16_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_843710 PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.372e-8 Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 2 Query: 23 VLLCFLFPALYTRIVVVWREKRTLGRNWSLNRKSLLRRPLRIEDTARGGYLRI 181 VLLCFLFPALY+RI WR L R+WSLNR+S L+R L +++ RG Y+R+ Sbjct: 375 VLLCFLFPALYSRIAA-WRRMIALKRSWSLNRRSFLKRTLPVKE--RGSYVRL 424
BLAST of GR914677 vs. TrEMBL
Match: D7TY64_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_97.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00038516001 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.093e-7 Identity = 32/53 (60.38%), Postives = 37/53 (69.81%), Query Frame = 2 Query: 23 VLLCFLFPALYTRIVVVWREKRTLGRNWSLNRKSLLRRPLRIEDTARGGYLRI 181 VLLCF FPA+Y RI WR +R L R+WSLNRKS L+R + RGGYLRI Sbjct: 405 VLLCFAFPAIYARIAS-WRRRRALRRSWSLNRKSFLKR--IPGGSERGGYLRI 454 The following BLAST results are available for this feature:
BLAST of GR914677 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR914677 ID=GR914677; Name=GR914677; organism=Cicer arietinum; type=EST; length=397bpback to top |