FE672572
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672572 vs. TrEMBL
Match: C6T8A7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 6.902e-10 Identity = 37/49 (75.51%), Postives = 41/49 (83.67%), Query Frame = 2 Query: 140 YNPLEKREVCKGGREVSKKSAHSQPSKKGGSTAQRHPSSH-ARRKDVSS 283 YNPLE+REVCKGGRE SKKSA+SQ S K GSTAQR SSH ARR +VS+ Sbjct: 125 YNPLERREVCKGGRETSKKSANSQASTK-GSTAQRPHSSHNARRNEVSN 172
BLAST of FE672572 vs. TrEMBL
Match: C6TB52_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.302e-8 Identity = 34/51 (66.67%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 140 YNPLEKREVCKGGREVSKKSAHSQPSKKGGSTAQRHPSSHARRKDVSSTGN 292 YNPLE+REV KGGRE SKKSA+SQ S K GSTAQR SSH R++ S N Sbjct: 125 YNPLERREVSKGGRETSKKSANSQASTK-GSTAQRPQSSHNSRRNEVSNAN 174
BLAST of FE672572 vs. TrEMBL
Match: B9H6K1_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_208732 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.900e-8 Identity = 31/50 (62.00%), Postives = 36/50 (72.00%), Query Frame = 2 Query: 140 YNPLEKREVCKGGREVSKKSAHSQPSKKGGSTAQRHPSSH-ARRKDVSST 286 YNPLE+RE CKGG+E SKK SQ S KG + A + SSH ARR DVSS+ Sbjct: 124 YNPLERREACKGGKEASKKCPQSQASSKGSTAAPKVQSSHNARRNDVSSS 173
BLAST of FE672572 vs. TrEMBL
Match: B9HH82_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_218504 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.946e-8 Identity = 30/49 (61.22%), Postives = 35/49 (71.43%), Query Frame = 2 Query: 140 YNPLEKREVCKGGREVSKKSAHSQPSKKGGSTAQRHPSSH-ARRKDVSS 283 YNP+E+RE CKGG+E SKK SQ S KG +TA + SSH RR DVSS Sbjct: 123 YNPMERREACKGGKETSKKCLQSQASSKGSTTAPKVQSSHNTRRNDVSS 171
BLAST of FE672572 vs. TrEMBL
Match: B9SG03_RICCO (Microtubule binding protein, putative OS=Ricinus communis GN=RCOM_1153500 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.142e-7 Identity = 28/52 (53.85%), Postives = 35/52 (67.31%), Query Frame = 2 Query: 140 YNPLEKREVCKGGREVSKKSAHSQPSKKGGSTAQRHPSSH-ARRKDVSSTGN 292 YNPLE+RE CKGG+E +KK SQ S KG + A + SSH ARR D +S + Sbjct: 101 YNPLERREACKGGKETTKKCPPSQSSAKGSTAAPKAQSSHNARRNDATSVNS 152 The following BLAST results are available for this feature:
BLAST of FE672572 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 5
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672572 ID=FE672572; Name=FE672572; organism=Cicer arietinum; type=EST; length=292bpback to top |