FE672947
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672947 vs. TrEMBL
Match: B7FK30_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.042e-13 Identity = 38/41 (92.68%), Postives = 39/41 (95.12%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 SLARLLGVDTD FCAKVQIEKG YDGRVLKAVEYEDICK+A Sbjct: 358 SLARLLGVDTDRFCAKVQIEKGAYDGRVLKAVEYEDICKVA 398
BLAST of FE672947 vs. TrEMBL
Match: B9HTJ4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_567434 PE=4 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.965e-12 Identity = 37/41 (90.24%), Postives = 38/41 (92.68%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S ARLLGVDT+ FCAKVQIEKG YDGRVLKAVEYEDICKLA Sbjct: 360 SNARLLGVDTEKFCAKVQIEKGIYDGRVLKAVEYEDICKLA 400
BLAST of FE672947 vs. TrEMBL
Match: B9HMH3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_832545 PE=4 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.965e-12 Identity = 37/41 (90.24%), Postives = 38/41 (92.68%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S ARLLGVDT+ FCAKVQIEKG YDGRVLKAVEYEDICKLA Sbjct: 356 SNARLLGVDTEKFCAKVQIEKGIYDGRVLKAVEYEDICKLA 396
BLAST of FE672947 vs. TrEMBL
Match: Q9ZVU5_ARATH (Putative uncharacterized protein At1g55460 OS=Arabidopsis thaliana GN=At1g55460 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 7.465e-12 Identity = 34/41 (82.93%), Postives = 38/41 (92.68%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S ARLLGVDT+ FCAKVQIEKG YDGRV+K++EYEDICKLA Sbjct: 371 SNARLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 411
BLAST of FE672947 vs. TrEMBL
Match: D7KM96_ARALY (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_682602 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.663e-11 Identity = 33/41 (80.49%), Postives = 38/41 (92.68%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S A+LLGVDT+ FCAKVQIEKG YDGRV+K++EYEDICKLA Sbjct: 81 SNAKLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 121
BLAST of FE672947 vs. TrEMBL
Match: D7KM94_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_474601 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.663e-11 Identity = 33/41 (80.49%), Postives = 38/41 (92.68%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S A+LLGVDT+ FCAKVQIEKG YDGRV+K++EYEDICKLA Sbjct: 372 SNAKLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 412
BLAST of FE672947 vs. TrEMBL
Match: B9SG74_RICCO (Zinc finger protein, putative OS=Ricinus communis GN=RCOM_1086480 PE=4 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.254e-11 Identity = 35/41 (85.37%), Postives = 36/41 (87.80%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S ARLL VDT+ FCA VQIEKG YDGRVLKAVEYEDICKLA Sbjct: 357 SNARLLKVDTEKFCAMVQIEKGIYDGRVLKAVEYEDICKLA 397
BLAST of FE672947 vs. TrEMBL
Match: Q75LU5_ORYSJ (KOW motif family protein, expressed OS=Oryza sativa subsp. japonica GN=OSJNBb0015I21.3 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.408e-10 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = -2 Query: 347 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKL 466 S ARLL VDT+ FCAKVQ+EKG YDG+VLKA+EYEDICK+ Sbjct: 389 SNARLLSVDTERFCAKVQVEKGLYDGKVLKAIEYEDICKI 428
BLAST of FE672947 vs. TrEMBL
Match: A3AJQ2_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_11495 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.408e-10 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = -2 Query: 347 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKL 466 S ARLL VDT+ FCAKVQ+EKG YDG+VLKA+EYEDICK+ Sbjct: 370 SNARLLSVDTERFCAKVQVEKGLYDGKVLKAIEYEDICKI 409
BLAST of FE672947 vs. TrEMBL
Match: A2XIP9_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_12309 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.408e-10 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = -2 Query: 347 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKL 466 S ARLL VDT+ FCAKVQ+EKG YDG+VLKA+EYEDICK+ Sbjct: 389 SNARLLSVDTERFCAKVQVEKGLYDGKVLKAIEYEDICKI 428
BLAST of FE672947 vs. TAIR peptide
Match: AT1G55460.1 (| Symbols: | DNA/RNA-binding protein Kin17, conserved region | chr1:20707567-20708802 FORWARD LENGTH=411) HSP 1 Score: 73.559 bits (179), Expect = 5.648e-14 Identity = 34/41 (82.93%), Postives = 38/41 (92.68%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S ARLLGVDT+ FCAKVQIEKG YDGRV+K++EYEDICKLA Sbjct: 371 SNARLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 411
BLAST of FE672947 vs. TAIR peptide
Match: AT5G51795.1 (| Symbols: | DNA/RNA-binding protein Kin17, conserved region | chr5:21043083-21044194 REVERSE LENGTH=347) HSP 1 Score: 68.1662 bits (165), Expect = 2.373e-12 Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = -2 Query: 344 SLARLLGVDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKLA 466 S RLL +DT+ FCAKVQIEKG YDGRV+K++EYEDICKLA Sbjct: 307 SNTRLLDLDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKLA 347 The following BLAST results are available for this feature:
BLAST of FE672947 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of FE672947 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672947 ID=FE672947; Name=FE672947; organism=Cicer arietinum; type=EST; length=467bpback to top |