HO062944

EST Overview
NameHO062944
Unique NameHO062944
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length424
Libraries
Library NameType
LIBEST_026409 Chickpea drought stressed cDNA SSH library AB2cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO062944 vs. SwissProt
Match: ACCO_PEA (1-aminocyclopropane-1-carboxylate oxidase OS=Pisum sativum GN=ACO PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.191e-11
Identity = 35/50 (70.00%), Postives = 39/50 (78.00%), Query Frame = -2
Query:  190 IFPAPPL*KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEA-MKPLSS 336
            I PA  L KENE SE+ PKF FDDY KLY+G KFQAK+PRFEA MK +SS
Sbjct:  259 ISPASTLLKENETSEVYPKFVFDDYMKLYMGLKFQAKEPRFEAMMKAMSS 308          
BLAST of HO062944 vs. SwissProt
Match: ACCO3_CUCME (1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.464e-11
Identity = 32/50 (64.00%), Postives = 40/50 (80.00%), Query Frame = -2
Query:  190 IFPAPPL*K-ENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L + E E++++ PKF FDDY KLYVG KFQAK+PRFEAMK + S
Sbjct:  260 IYPAPALVEGEQEKTKLYPKFVFDDYMKLYVGLKFQAKEPRFEAMKAMES 309          
BLAST of HO062944 vs. SwissProt
Match: ACCO_ACTDE (1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.316e-10
Identity = 33/73 (45.21%), Postives = 47/73 (64.38%), Query Frame = -2
Query:  190 IVQPEG--VGFLSSFPIRGXCFIFPAPPL*--KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 396
            I QP+G  +   S +       ++PAP L   +E++Q ++ PKF F+DY KLY G KFQAK+PRFEAMK + +
Sbjct:  237 IAQPDGNRMSIASFYNPGSDAVMYPAPALVDKEEDQQKQVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMEN 309          
BLAST of HO062944 vs. SwissProt
Match: ACCO_DIOKA (1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.933e-10
Identity = 31/50 (62.00%), Postives = 37/50 (74.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE E+ E+ PKF FDDY KLY   KFQAK+PRFEAMK + +
Sbjct:  259 IYPAPALVEKEVEEKEVYPKFVFDDYMKLYAALKFQAKEPRFEAMKAVEA 308          
BLAST of HO062944 vs. SwissProt
Match: ACCO1_PETHY (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 6.533e-10
Identity = 36/73 (49.32%), Postives = 46/73 (63.01%), Query Frame = -2
Query:  190 IVQPEGVGF-LSSFPIRGX-CFIFPAPPL*KEN--EQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 396
            I Q +G    L+SF   G    I+PAP L ++   E  ++ PKF FDDY KLY G KFQAK+PRFEAMK + +
Sbjct:  237 IAQKDGARMSLASFYNPGSDAVIYPAPALVEKEAEENKQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMET 309          
BLAST of HO062944 vs. SwissProt
Match: ACCO4_SOLLC (1-aminocyclopropane-1-carboxylate oxidase 4 OS=Solanum lycopersicum GN=ACO4 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 8.532e-10
Identity = 36/71 (50.70%), Postives = 46/71 (64.79%), Query Frame = -2
Query:  190 IVQPEGVGF-LSSFPIRGX-CFIFPAPPL*KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 396
            I Q +G    L+SF   G    I+PAP L +E++Q  + PKF FDDY KLY G KFQ K+PRFEAMK + +
Sbjct:  237 IAQTDGTRMSLASFYNPGNDAVIYPAPSLIEESKQ--VYPKFVFDDYMKLYAGLKFQPKEPRFEAMKAMEA 305          
BLAST of HO062944 vs. SwissProt
Match: ACCO1_CUCME (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 8.532e-10
Identity = 36/71 (50.70%), Postives = 47/71 (66.20%), Query Frame = -2
Query:  202 IVQPEGVGFLS--SFPIRGX-CFIFPAPPL*KEN---EQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMK 396
            + Q  G G +S  SF   G    I+PAP L +++   E+ E+ PKF F+DY KLY+G KFQAK+PRFEAMK
Sbjct:  237 LTQTSGTGRMSIASFYNPGSDAVIYPAPALVEKDQDEEKKEVYPKFVFEDYMKLYLGVKFQAKEPRFEAMK 307          
BLAST of HO062944 vs. SwissProt
Match: ACCO2_MALDO (1-aminocyclopropane-1-carboxylate oxidase 2 OS=Malus domestica GN=ACO2 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.114e-9
Identity = 32/47 (68.09%), Postives = 35/47 (74.47%), Query Frame = -2
Query:  202 FIFPAPPL*KE-NEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMK 339
            FI PAP L +E +E S   PKF FDDY KLY G KFQAK+PRFEAMK
Sbjct:  258 FISPAPALLEEKSEVSPTYPKFLFDDYMKLYSGLKFQAKEPRFEAMK 304          
BLAST of HO062944 vs. SwissProt
Match: ACCO_TOBAC (1-aminocyclopropane-1-carboxylate oxidase OS=Nicotiana tabacum GN=ACO PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.455e-9
Identity = 40/68 (58.82%), Postives = 45/68 (66.18%), Query Frame = -2
Query:  205 IVQPEGVGF-LSSFPIRGX-CFIFPAPPL*-KENEQSE-ISPKFFFDDYRKLYVGFKFQAKDPRFEAM 396
            I Q +G    L+SF   G    IFPAP L  KE E+S+ I PKF FDDY KLY G KFQAK+PRFEAM
Sbjct:  237 ITQTDGTRMSLASFYNPGSDAVIFPAPTLVEKEAEESKAIYPKFVFDDYMKLYAGLKFQAKEPRFEAM 304          
BLAST of HO062944 vs. SwissProt
Match: ACCO1_SOLLC (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Solanum lycopersicum GN=ACO1 PE=2 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 1.901e-9
Identity = 36/73 (49.32%), Postives = 46/73 (63.01%), Query Frame = -2
Query:  190 IVQPEGVGF-LSSFPIRGX-CFIFPAPPL*KEN--EQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 396
            I Q +G    L+SF   G    I+PA  L ++   E +++ PKF FDDY KLY G KFQAK+PRFEAMK + S
Sbjct:  237 IAQTDGTRMSLASFYNPGSDAVIYPAKTLVEKEAEESTQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMES 309          
BLAST of HO062944 vs. TrEMBL
Match: Q9ZRC9_CARPA (1-aminocyclopropane-1-carboxylate oxidase OS=Carica papaya GN=aco2 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-10
Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE E+++I PKF FDDY KLYVG KFQAK+PRFEAMK + S
Sbjct:  259 IYPAPSLVEKEAEKNQIYPKFVFDDYMKLYVGLKFQAKEPRFEAMKAMES 308          
BLAST of HO062944 vs. TrEMBL
Match: Q9M4U2_CARPA (ACC oxidase OS=Carica papaya PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-10
Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE E+++I PKF FDDY KLYVG KFQAK+PRFEAMK + S
Sbjct:  259 IYPAPSLVEKEAEKNQIYPKFVFDDYMKLYVGLKFQAKEPRFEAMKAMES 308          
BLAST of HO062944 vs. TrEMBL
Match: Q94JL7_CARPA (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Carica papaya PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-10
Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE E+++I PKF FDDY KLYVG KFQAK+PRFEAMK + S
Sbjct:  259 IYPAPSLVEKEAEKNQIYPKFVFDDYMKLYVGLKFQAKEPRFEAMKAMES 308          
BLAST of HO062944 vs. TrEMBL
Match: Q8W2D6_CARPA (1-aminocyclopropane-1-carboxylate oxidase OS=Carica papaya GN=ACO2 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-10
Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE E+++I PKF FDDY KLYVG KFQAK+PRFEAMK + S
Sbjct:  259 IYPAPSLVEKEAEKNQIYPKFVFDDYMKLYVGLKFQAKEPRFEAMKAMES 308          
BLAST of HO062944 vs. TrEMBL
Match: Q84X67_VITVI (1-aminocyclopropane-1-carboxylic acid oxidase 1 (Fragment) OS=Vitis vinifera GN=ACO1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-10
Identity = 42/76 (55.26%), Postives = 49/76 (64.47%), Query Frame = -2
Query:  196 GVGSPGIVQPEGVGF-LSSFPIRGX-CFIFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPL 414
            GV    I Q +G G  L+SF   G    I+PAP L  KE E SE+ PKF F+DY KLY G KFQAK+PRFEAMK +
Sbjct:  206 GVMHRVIAQTDGNGMSLASFYNPGSDAVIYPAPALVEKEKETSEVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAM 281          
BLAST of HO062944 vs. TrEMBL
Match: Q5W1M7_CARPA (1-aminocyclopropane-1-carboxylate oxidase OS=Carica papaya GN=ACO2 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-10
Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE E+++I PKF FDDY KLYVG KFQAK+PRFEAMK + S
Sbjct:  259 IYPAPSLVEKEAEKNQIYPKFVFDDYMKLYVGLKFQAKEPRFEAMKAMES 308          
BLAST of HO062944 vs. TrEMBL
Match: C6TMZ4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-10
Identity = 32/49 (65.31%), Postives = 37/49 (75.51%), Query Frame = -2
Query:  190 IFPAPPL*KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I PAP L KE+E S++ PKF FDDY KLY G KFQAK+PRF+AMK   S
Sbjct:  259 IAPAPALVKEDETSQVYPKFVFDDYMKLYAGLKFQAKEPRFQAMKATES 307          
BLAST of HO062944 vs. TrEMBL
Match: Q6UA20_GOSBA (1-aminocyclopropane-1-carboxylic acid oxidase (Fragment) OS=Gossypium barbadense PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.411e-10
Identity = 32/50 (64.00%), Postives = 40/50 (80.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE ++S++ PKF F+DY KLY G KFQAK+PRFEAMKP+ S
Sbjct:  219 IYPAPALLEKEADKSQVCPKFVFEDYMKLYAGLKFQAKEPRFEAMKPVES 268          
BLAST of HO062944 vs. TrEMBL
Match: A9PJ26_9ROSI (Putative uncharacterized protein OS=Populus trichocarpa x Populus deltoides PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.113e-10
Identity = 33/50 (66.00%), Postives = 39/50 (78.00%), Query Frame = -2
Query:  190 IFPAPPL*-KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            I+PAP L  KE E+S+I PKF F+DY KLY G KFQAK+PRFEAMK + S
Sbjct:  259 IYPAPELVEKEEEESQIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVES 308          
BLAST of HO062944 vs. TrEMBL
Match: Q9XER2_TRIRP (1-aminocyclopropane-1-carboxylate oxidase OS=Trifolium repens GN=ACO1 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 5.371e-10
Identity = 37/51 (72.55%), Postives = 40/51 (78.43%), Query Frame = -2
Query:  190 IFPAPPL*KENEQ-SEISPKFFFDDYRKLYVGFKFQAKDPRFEA-MKPLSS 336
            I PAP L KENE  SEI PKF FDDY KLY+G KFQAK+PRFEA MK +SS
Sbjct:  259 ISPAPTLLKENETTSEIYPKFVFDDYMKLYMGLKFQAKEPRFEAMMKAMSS 309          
BLAST of HO062944 vs. TAIR peptide
Match: AT1G05010.1 (| Symbols: EFE, ACO4, EAT1 | ethylene-forming enzyme | chr1:1431419-1432695 REVERSE LENGTH=323)

HSP 1 Score: 56.9954 bits (136), Expect = 4.457e-9
Identity = 29/52 (55.77%), Postives = 35/52 (67.31%), Query Frame = -2
Query:  190 IFPAPPL*---KENEQSEISPKFFFDDYRKLYVGFKFQAKDPRFEAMKPLSS 336
            IFPAP L     E E+ E  P+F F+DY KLY   KFQAK+PRFEAMK + +
Sbjct:  260 IFPAPELIGKEAEKEKKENYPRFVFEDYMKLYSAVKFQAKEPRFEAMKAMET 311          
BLAST of HO062944 vs. TAIR peptide
Match: AT1G12010.1 (| Symbols: | 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr1:4056274-4057670 FORWARD LENGTH=320)

HSP 1 Score: 51.6026 bits (122), Expect = 1.872e-7
Identity = 22/28 (78.57%), Postives = 23/28 (82.14%), Query Frame = -2
Query:  202 PKFFFDDYRKLYVGFKFQAKDPRFEAMK 285
            P F FDDY KLY G KFQAK+PRFEAMK
Sbjct:  276 PSFVFDDYMKLYAGLKFQAKEPRFEAMK 303          
The following BLAST results are available for this feature:
BLAST of HO062944 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
ACCO_PEA1.191e-1170.001-aminocyclopropane-1-carboxylate oxidase OS=Pisum... [more]
ACCO3_CUCME3.464e-1164.001-aminocyclopropane-1-carboxylate oxidase 3 OS=Cuc... [more]
ACCO_ACTDE1.316e-1045.211-aminocyclopropane-1-carboxylate oxidase OS=Actin... [more]
ACCO_DIOKA2.933e-1062.001-aminocyclopropane-1-carboxylate oxidase OS=Diosp... [more]
ACCO1_PETHY6.533e-1049.321-aminocyclopropane-1-carboxylate oxidase 1 OS=Pet... [more]
ACCO4_SOLLC8.532e-1050.701-aminocyclopropane-1-carboxylate oxidase 4 OS=Sol... [more]
ACCO1_CUCME8.532e-1050.701-aminocyclopropane-1-carboxylate oxidase 1 OS=Cuc... [more]
ACCO2_MALDO1.114e-968.091-aminocyclopropane-1-carboxylate oxidase 2 OS=Mal... [more]
ACCO_TOBAC1.455e-958.821-aminocyclopropane-1-carboxylate oxidase OS=Nicot... [more]
ACCO1_SOLLC1.901e-949.321-aminocyclopropane-1-carboxylate oxidase 1 OS=Sol... [more]
back to top
BLAST of HO062944 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q9ZRC9_CARPA1.846e-1068.001-aminocyclopropane-1-carboxylate oxidase OS=Caric... [more]
Q9M4U2_CARPA1.846e-1068.00ACC oxidase OS=Carica papaya PE=2 SV=1[more]
Q94JL7_CARPA1.846e-1068.001-aminocyclopropane-1-carboxylate oxidase 1 OS=Car... [more]
Q8W2D6_CARPA1.846e-1068.001-aminocyclopropane-1-carboxylate oxidase OS=Caric... [more]
Q84X67_VITVI1.846e-1055.261-aminocyclopropane-1-carboxylic acid oxidase 1 (F... [more]
Q5W1M7_CARPA1.846e-1068.001-aminocyclopropane-1-carboxylate oxidase OS=Caric... [more]
C6TMZ4_SOYBN1.846e-1065.31Putative uncharacterized protein OS=Glycine max PE... [more]
Q6UA20_GOSBA2.411e-1064.001-aminocyclopropane-1-carboxylic acid oxidase (Fra... [more]
A9PJ26_9ROSI4.113e-1066.00Putative uncharacterized protein OS=Populus tricho... [more]
Q9XER2_TRIRP5.371e-1072.551-aminocyclopropane-1-carboxylate oxidase OS=Trifo... [more]
back to top
BLAST of HO062944 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT1G05010.14.457e-955.77| Symbols: EFE, ACO4, EAT1 | ethylene-forming enzy... [more]
AT1G12010.11.872e-778.57| Symbols: | 2-oxoglutarate (2OG) and Fe(II)-depe... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR10209IRON/ASCORBATE-DEPENDENT OXIDOREDUCTASE FAMILY MEMBERcoord: 2..37
score: 1.7
NoneNo IPR availablePANTHERPTHR10209:SF121-AMINOCYCLOPROPANE-1-CARBOXYLATE OXIDASEcoord: 2..37
score: 1.7

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO062944 ID=HO062944|Name=HO062944|organism=Cicer arietinum|type=EST|length=424bp
GGGCTAATAATCATACTTTATTTTAATATAAACTAACATTTAAACTGCAC
AATCTTAAGCTCCCAAACCAATTATCACACACACCCATAAACTCAGCTTA
TTAGCATAAGCATATATAATTAATATTCTAATATGCTTTTTCATATGCTC
ACCAACAACTTAAACTGTCACTACCGGTCCCCCCTCAACACTTGATAAAG
GCTTCATAGCTTCAAATCTAGGGTCTTTAGCTTGGAATTTGAAACCCACA
TAAAGCTTCCTGTAATCATCAAAAAAAAATTTTGGGGAAATTTCACTTTG
TTCATTTTCCTTTTACAAAGGTGGGGCTGGAAAAATAAAACANCTCCCCC
GGATTGGGAATGAACTAAGAAATCCTACCCCCTCTGGTTGAACAATACCC
GGGGATCCCACTCCTGGACTTCCC
back to top