HO067617

EST Overview
NameHO067617
Unique NameHO067617
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length558
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO067617 vs. SwissProt
Match: Y2168_ARATH (Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 3.018e-70
Identity = 136/179 (75.98%), Postives = 155/179 (86.59%), Query Frame = 2
Query:   11 VVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKSNIA 547
            VVEEILQAD TILNERD+KGNTALH+ATRK+R QI  LLL++ +++VNAIN Q+ETA+DLADKL Y  SALEI EAL E GAK+ R +G+  EA  LKR VSDIKHEVQSQL+QNEKT RRVSGIAKEL+KLHREAVQNT NS+TVVAVLFASIAFLAIFNLPGQY T+GS  G++NIA
Sbjct:  211 VVEEILQADYTILNERDRKGNTALHIATRKARPQITSLLLTFTAIEVNAINNQKETAMDLADKLQYSESALEINEALVEAGAKHGRFIGREDEARALKRAVSDIKHEVQSQLLQNEKTNRRVSGIAKELRKLHREAVQNTTNSITVVAVLFASIAFLAIFNLPGQYFTEGSHVGQANIA 389          
BLAST of HO067617 vs. SwissProt
Match: Y5262_ARATH (Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.083e-35
Identity = 79/174 (45.40%), Postives = 113/174 (64.94%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKV------GEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY 508
            T +V+ +++AD +++N  D KGNT LH+A RK+R++IV  +L Y  +   A+NK  ETALD+A+K    T   EI   L + G + AR +         G + +LK TVS+I HEV +QL Q  +TRR + GIAK + K+H E + N INS T+VA+L A++AF AIFN+PGQY
Sbjct:  206 TEIVDVLMEADGSLINSADNKGNTPLHIAVRKNRAEIVQTVLKYCEVSRVAVNKSGETALDIAEK----TGLHEIVPLLQKIGMQNARSIKPAEKVEPSGSSRKLKETVSEIGHEVHTQLEQTGRTRREIQGIAKRVNKMHTEGLNNAINSTTLVAILIATVAFAAIFNVPGQY 375          
BLAST of HO067617 vs. SwissProt
Match: Y3236_ARATH (Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.415e-35
Identity = 82/173 (47.40%), Postives = 114/173 (65.90%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGS 523
            + VV+ +L ADP I+ + DK  NTALH+ATRK R++IV LLLS    + N + +  +TALD+A+ LP    +  I+E LA  GA  A  + +  +  EL+ TV+ IK++V  QL Q ++T + V  I+KEL+KLHRE + N  NSVTVVAVLFA++AF AIF +PG     GS
Sbjct:  279 SEVVKLLLDADPAIVMQPDKSCNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLARSGALRANELNQPRD--ELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFAAIFTVPGGDNNDGS 449          
BLAST of HO067617 vs. TrEMBL
Match: A9PDX2_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 3.388e-76
Identity = 150/184 (81.52%), Postives = 166/184 (90.22%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKSNIADHV 556
            TSVVEEIL AD +ILNERDKKGNTA+H+ATRKSR QI+ LLLSY S++VN IN ++ETA+DLADKL YG SALEI+EAL E GAK+ARHVG++ EAMELKRTVSDIKHEV SQLIQNEKT RRVSGIAKEL+KLHREAVQNT NSVTVVAVLFASIAFLAIFNLPGQYI  G+ETGK+NIAD V
Sbjct:  203 TSVVEEILLADHSILNERDKKGNTAVHIATRKSRPQIIFLLLSYTSINVNIINNERETAMDLADKLQYGESALEIKEALIEAGAKHARHVGQMDEAMELKRTVSDIKHEVHSQLIQNEKTNRRVSGIAKELRKLHREAVQNTTNSVTVVAVLFASIAFLAIFNLPGQYIQDGAETGKANIADSV 386          
BLAST of HO067617 vs. TrEMBL
Match: B9HW17_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_566441 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 2.196e-75
Identity = 149/184 (80.98%), Postives = 165/184 (89.67%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKSNIADHV 556
            TSVVEEIL AD +ILNERDKKGNTA+H+ATRKSR QI+ LLLSY S++VN IN ++ETA+DLADKL YG SALEI+EAL E GAK+ARHVG++ EAMELKRTVSDIKHEV SQLIQNEKT RRVSGIAKEL+KLHREAVQNT NSVTVVAVLFASIAFLAIFNLPGQYI  G+ETGK+NIA  V
Sbjct:  200 TSVVEEILVADHSILNERDKKGNTAVHIATRKSRPQIIFLLLSYTSINVNIINNERETAMDLADKLQYGESALEIKEALIEAGAKHARHVGQMDEAMELKRTVSDIKHEVHSQLIQNEKTNRRVSGIAKELRKLHREAVQNTTNSVTVVAVLFASIAFLAIFNLPGQYIQDGAETGKANIAGSV 383          
BLAST of HO067617 vs. TrEMBL
Match: B9HJG3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_720211 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 4.893e-75
Identity = 148/184 (80.43%), Postives = 164/184 (89.13%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKSNIADHV 556
            TSVVEEI  AD +ILNERDKKGNTA+H+ATRKSR QI+ LLL+Y S+DVN IN Q ETA+DLADKLPYG SALEI+EAL E GAK+ARHVG++ EAMELKRTVSDIKHEV SQLIQNEKT RRVSGIAKEL+K+HREAVQNT NSVTVVAVLFASIAFLAIFNLPGQYI  G+ET K+ IAD+V
Sbjct:  203 TSVVEEIFLADRSILNERDKKGNTAVHVATRKSRPQIISLLLNYISIDVNIINNQHETAMDLADKLPYGESALEIKEALTEAGAKHARHVGQMDEAMELKRTVSDIKHEVHSQLIQNEKTNRRVSGIAKELRKIHREAVQNTTNSVTVVAVLFASIAFLAIFNLPGQYIQDGAETRKAYIADNV 386          
BLAST of HO067617 vs. TrEMBL
Match: B9SJ26_RICCO (Ankyrin repeat-containing protein, putative OS=Ricinus communis GN=RCOM_0598000 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.506e-73
Identity = 144/184 (78.26%), Postives = 163/184 (88.59%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKSNIADHV 556
            T+VVEEIL AD +ILNERDKKGNTA+H+ATRKSR  IV LLL+Y S+DVN IN Q+ETA+DLADKL YG S++EI+EAL + GAK+AR+VG V EAMELKRTVSDIKHEV SQLIQNEKT RRVSGIAKEL+KLHREAVQNT NSVTVVAVLF+SIAFLAIFNLPGQY+  G E GK+NIAD+V
Sbjct:  206 TAVVEEILSADCSILNERDKKGNTAVHIATRKSRPVIVSLLLTYRSIDVNVINNQRETAMDLADKLQYGESSMEIKEALTDAGAKHARYVGTVDEAMELKRTVSDIKHEVHSQLIQNEKTNRRVSGIAKELRKLHREAVQNTTNSVTVVAVLFSSIAFLAIFNLPGQYLMDGGEVGKANIADNV 389          
BLAST of HO067617 vs. TrEMBL
Match: D7T8L5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00011665001 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.247e-70
Identity = 141/182 (77.47%), Postives = 158/182 (86.81%), Query Frame = 2
Query:   11 VVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKSNIADHV 556
            VV+E+L AD +ILNERDKKGNTA+H+ATRK R QIV LLLSY S+DVN IN Q+ETA+DL DKL YG S LEI++ALAE GAK+AR+VG+  E MELKRTVSDIKHEV SQLIQNEKT+RRVSGIAKEL+KLHREAVQNT NSVTVVAVLFAS AFLAIFNLPGQYI  G E GK+ IAD+V
Sbjct:  124 VVDELLAADHSILNERDKKGNTAVHIATRKCRPQIVSLLLSYRSVDVNVINNQKETAMDLVDKLQYGESKLEIKDALAESGAKHARYVGQEDETMELKRTVSDIKHEVHSQLIQNEKTQRRVSGIAKELRKLHREAVQNTTNSVTVVAVLFASTAFLAIFNLPGQYIMGGPEVGKARIADNV 305          
BLAST of HO067617 vs. TrEMBL
Match: B6TEZ8_MAIZE (Protein binding protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 8.102e-62
Identity = 127/184 (69.02%), Postives = 149/184 (80.98%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY---ITKGSETGKSNIA 547
            T VVEE+L AD +ILN RDKKGNTALH+ATRK R Q+V LLLSY SL+VNAIN Q ETA+DLADK+PYG S  EI E L E GAK AR+VGK+ EA EL+RTVSDIKH VQ+QL +N KT +RV+GI KEL+KLHREA+QNTINSVT+VA L ASIAF+AIFNLPGQY   +  G + G++ IA
Sbjct:    8 TDVVEELLMADVSILNVRDKKGNTALHIATRKWRPQMVQLLLSYESLEVNAINSQNETAMDLADKVPYGESKTEIIEWLTEAGAKNARNVGKIDEASELRRTVSDIKHNVQAQLSENAKTNKRVTGIRKELQKLHREAIQNTINSVTLVATLIASIAFVAIFNLPGQYFQDVNSGGDIGEAEIA 191          
BLAST of HO067617 vs. TrEMBL
Match: A3AB47_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_08297 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 4.021e-61
Identity = 126/185 (68.11%), Postives = 151/185 (81.62%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYIT---KGSETGKSNIAD 550
            T VVEE+L AD +ILN RDKK NTALH+ATRK R Q+V LLLSY +L+VNAIN Q ETA+DLA+K+PYG S +EI E L E GAK AR+VGK+ EA EL+RTVSDIKH VQ+QL +N KT +RV+GIAKEL+KLHREAVQNTINSVT+VA L ASIAF+AIFNLPGQY      G + G+++IA+
Sbjct:  156 TDVVEELLMADVSILNVRDKKANTALHIATRKWRPQMVQLLLSYEALEVNAINNQNETAMDLAEKVPYGESKMEIIEWLTEAGAKNARNVGKIDEASELRRTVSDIKHNVQAQLNENAKTNKRVTGIAKELRKLHREAVQNTINSVTMVATLIASIAFVAIFNLPGQYYVDRDSGGDIGEAHIAN 340          
BLAST of HO067617 vs. TrEMBL
Match: A2X9C6_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_08844 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 4.021e-61
Identity = 126/185 (68.11%), Postives = 151/185 (81.62%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYIT---KGSETGKSNIAD 550
            T VVEE+L AD +ILN RDKK NTALH+ATRK R Q+V LLLSY +L+VNAIN Q ETA+DLA+K+PYG S +EI E L E GAK AR+VGK+ EA EL+RTVSDIKH VQ+QL +N KT +RV+GIAKEL+KLHREAVQNTINSVT+VA L ASIAF+AIFNLPGQY      G + G+++IA+
Sbjct:  198 TDVVEELLMADVSILNVRDKKANTALHIATRKWRPQMVQLLLSYEALEVNAINNQNETAMDLAEKVPYGESKMEIIEWLTEAGAKNARNVGKIDEASELRRTVSDIKHNVQAQLNENAKTNKRVTGIAKELRKLHREAVQNTINSVTMVATLIASIAFVAIFNLPGQYYVDRDSGGDIGEAHIAN 382          
BLAST of HO067617 vs. TrEMBL
Match: Q6Z750_ORYSJ (Ankyrin-like protein OS=Oryza sativa subsp. japonica GN=P0487D09.13 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.528e-60
Identity = 125/185 (67.57%), Postives = 151/185 (81.62%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYIT---KGSETGKSNIAD 550
            T VVEE+L AD +IL+ RDKK NTALH+ATRK R Q+V LLLSY +L+VNAIN Q ETA+DLA+K+PYG S +EI E L E GAK AR+VGK+ EA EL+RTVSDIKH VQ+QL +N KT +RV+GIAKEL+KLHREAVQNTINSVT+VA L ASIAF+AIFNLPGQY      G + G+++IA+
Sbjct:  198 TDVVEELLMADVSILDVRDKKANTALHIATRKWRPQMVQLLLSYEALEVNAINNQNETAMDLAEKVPYGESKMEIIEWLTEAGAKNARNVGKIDEASELRRTVSDIKHNVQAQLNENAKTNKRVTGIAKELRKLHREAVQNTINSVTMVATLIASIAFVAIFNLPGQYYVDRDSGGDIGEAHIAN 382          
BLAST of HO067617 vs. TrEMBL
Match: C5XZ99_SORBI (Putative uncharacterized protein Sb04g028680 OS=Sorghum bicolor GN=Sb04g028680 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.404e-60
Identity = 126/185 (68.11%), Postives = 150/185 (81.08%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSY-ASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY---ITKGSETGKSNIA 547
            T VVEE+L AD +ILN RDKKGNTALH+ATRK R Q+V LLLSY  +L+VNAIN Q ETA+DLADK+PYG S  EI E L E GAK AR+VGK+ EA EL+RTVSDIKH VQ+QL +N KT +RV+GI KEL+KLHREA+QNTINSVT+VA L ASIAF+AIFNLPGQY   +  G + G+++IA
Sbjct:  200 TDVVEELLMADVSILNVRDKKGNTALHIATRKWRPQMVQLLLSYDETLEVNAINSQNETAMDLADKVPYGESKTEIIEWLTEAGAKNARNVGKIDEASELRRTVSDIKHNVQAQLSENAKTNKRVTGIRKELQKLHREAIQNTINSVTMVATLIASIAFVAIFNLPGQYFQDVNSGGDIGEAHIA 384          
BLAST of HO067617 vs. TAIR peptide
Match: AT2G01680.1 (| Symbols: | Ankyrin repeat family protein | chr2:306597-308427 FORWARD LENGTH=532)

HSP 1 Score: 264.233 bits (674), Expect = 3.239e-71
Identity = 136/179 (75.98%), Postives = 155/179 (86.59%), Query Frame = 2
Query:   11 VVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKSNIA 547
            VVEEILQAD TILNERD+KGNTALH+ATRK+R QI  LLL++ +++VNAIN Q+ETA+DLADKL Y  SALEI EAL E GAK+ R +G+  EA  LKR VSDIKHEVQSQL+QNEKT RRVSGIAKEL+KLHREAVQNT NS+TVVAVLFASIAFLAIFNLPGQY T+GS  G++NIA
Sbjct:  211 VVEEILQADYTILNERDRKGNTALHIATRKARPQITSLLLTFTAIEVNAINNQKETAMDLADKLQYSESALEINEALVEAGAKHGRFIGREDEARALKRAVSDIKHEVQSQLLQNEKTNRRVSGIAKELRKLHREAVQNTTNSITVVAVLFASIAFLAIFNLPGQYFTEGSHVGQANIA 389          
BLAST of HO067617 vs. TAIR peptide
Match: AT1G07710.1 (| Symbols: | Ankyrin repeat family protein | chr1:2386275-2387986 REVERSE LENGTH=543)

HSP 1 Score: 161.77 bits (408), Expect = 2.264e-40
Identity = 95/187 (50.80%), Postives = 122/187 (65.24%), Query Frame = 2
Query:   11 VVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGE--AMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY------ITKGSETGKSNIA 547
            VVEE+++AD + +N  D KGNTALH+A RK RSQIV LLL+    D  A+N+  ETALD A+K+     AL +Q+    +G   A+ +   G   A ELK+TVSDIKHEV +QL     TR+RV GIAK+L K+H E + N INS TVVAVL A++AF AIF +PGQY      I  G   G++NIA
Sbjct:  218 VVEELIKADRSSINIADTKGNTALHIAARKGRSQIVKLLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQK----HGVPSAKTIKPSGPNPARELKQTVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAIFTVPGQYVEDTSKIPDGHSLGEANIA 400          
BLAST of HO067617 vs. TAIR peptide
Match: AT2G31820.1 (| Symbols: | Ankyrin repeat family protein | chr2:13530350-13532562 FORWARD LENGTH=662)

HSP 1 Score: 152.525 bits (384), Expect = 1.373e-37
Identity = 88/184 (47.83%), Postives = 122/184 (66.30%), Query Frame = 2
Query:   11 VVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKV-GEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY---ITKGSETGKSNIAD 550
            +V E+++ D  +L+  D KGNT LH+AT K R +IV  L+S+  +++N INK  +T LD+++K+       E+   L E GA  A+ +GK    A +LK+TVSDIKHEVQSQL Q+ +T  RV  IAK LKKLH   + N INS TVVAVL A++AF AIF +PGQY    +KG   G+++IA+
Sbjct:  341 IVVELVKPDVAVLSVEDNKGNTPLHIATNKGRIKIVRCLVSFEGINLNPINKAGDTPLDVSEKI----GNAELVSVLKEAGAATAKDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTIPGQYEEDRSKGELLGQAHIAN 520          
BLAST of HO067617 vs. TAIR peptide
Match: AT1G05640.1 (| Symbols: | Ankyrin repeat family protein | chr1:1687436-1689501 REVERSE LENGTH=627)

HSP 1 Score: 152.525 bits (384), Expect = 1.373e-37
Identity = 86/167 (51.50%), Postives = 113/167 (67.66%), Query Frame = 2
Query:   11 VVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKV-GEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY 508
            +V E+++ DP IL+  D KGNT LH AT K R +IV  L+S+  +++NA+NK  +TALD+A+K+       E+   L E GA  A+ +GK    A +L +TVSDIKHEVQSQL Q+ +T  RV  IAK LKKLH   + N INS TVVAVL A++AF AIF +PGQY
Sbjct:  305 IVLELVKPDPAILSVEDSKGNTPLHTATNKGRIKIVRCLVSFDGINLNAMNKAGDTALDIAEKI----GNPELVSVLKEAGAATAKDLGKPRNPAKQLNQTVSDIKHEVQSQLQQSRQTGVRVRRIAKRLKKLHINGLNNAINSATVVAVLIATVAFAAIFTIPGQY 467          
BLAST of HO067617 vs. TAIR peptide
Match: AT5G02620.1 (| Symbols: ANK1, ATANK1 | ankyrin-like1 | chr5:589666-591536 FORWARD LENGTH=524)

HSP 1 Score: 149.443 bits (376), Expect = 1.163e-36
Identity = 79/174 (45.40%), Postives = 113/174 (64.94%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKV------GEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY 508
            T +V+ +++AD +++N  D KGNT LH+A RK+R++IV  +L Y  +   A+NK  ETALD+A+K    T   EI   L + G + AR +         G + +LK TVS+I HEV +QL Q  +TRR + GIAK + K+H E + N INS T+VA+L A++AF AIFN+PGQY
Sbjct:  206 TEIVDVLMEADGSLINSADNKGNTPLHIAVRKNRAEIVQTVLKYCEVSRVAVNKSGETALDIAEK----TGLHEIVPLLQKIGMQNARSIKPAEKVEPSGSSRKLKETVSEIGHEVHTQLEQTGRTRREIQGIAKRVNKMHTEGLNNAINSTTLVAILIATVAFAAIFNVPGQY 375          
BLAST of HO067617 vs. TAIR peptide
Match: AT3G12360.1 (| Symbols: ITN1 | Ankyrin repeat family protein | chr3:3934146-3936495 FORWARD LENGTH=590)

HSP 1 Score: 149.058 bits (375), Expect = 1.518e-36
Identity = 82/173 (47.40%), Postives = 114/173 (65.90%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGS 523
            + VV+ +L ADP I+ + DK  NTALH+ATRK R++IV LLLS    + N + +  +TALD+A+ LP    +  I+E LA  GA  A  + +  +  EL+ TV+ IK++V  QL Q ++T + V  I+KEL+KLHRE + N  NSVTVVAVLFA++AF AIF +PG     GS
Sbjct:  279 SEVVKLLLDADPAIVMQPDKSCNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLARSGALRANELNQPRD--ELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFAAIFTVPGGDNNDGS 449          
BLAST of HO067617 vs. TAIR peptide
Match: AT3G09550.1 (| Symbols: | Ankyrin repeat family protein | chr3:2932007-2934199 FORWARD LENGTH=607)

HSP 1 Score: 148.288 bits (373), Expect = 2.590e-36
Identity = 80/166 (48.19%), Postives = 111/166 (66.87%), Query Frame = 2
Query:    5 TSVVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPG 502
            + VV  +L+ADP I+   DK GNT LH+ATRK R++IV  LL     +VNA+ +  +TA D+A+ L +     EI+E L+  GA  A  + +  +  EL++TV++IK +V +QL Q  KT + V GIAKEL+KLHR  + N  NSVTVVAVLFA++AF AIF +PG
Sbjct:  293 SQVVRLLLRADPAIVMLPDKFGNTVLHIATRKKRAEIVNELLQLPDTNVNALTRDHKTAYDIAEGLTHSEETAEIKEILSRCGALKANELNQPRD--ELRKTVTEIKKDVHTQLEQTRKTNKNVDGIAKELRKLHRAGINNATNSVTVVAVLFATVAFAAIFTVPG 456          
BLAST of HO067617 vs. TAIR peptide
Match: AT5G60070.1 (| Symbols: | ankyrin repeat family protein | chr5:24190440-24192570 REVERSE LENGTH=548)

HSP 1 Score: 144.436 bits (363), Expect = 3.740e-35
Identity = 91/191 (47.64%), Postives = 115/191 (60.21%), Query Frame = 2
Query:   11 VVEEILQADPTILNERDKKGNTALHMATRKSRSQIVILLL--SYASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYG---AKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQY------ITKGSETGKSNIAD 550
            VV E+++   + LN  D KGNTALH+ATRK R +IV LLL  +  S    AIN+  ET LD A+K    T   +I   L   G   AK   +  +   A ELK+TVSDIKHEV  QL    +TR+RV GIAK + K+H E + N INS TVVAVL A++AF AIF +PGQY      +  G   G++NIAD
Sbjct:  226 VVVELMKGHRSSLNMADSKGNTALHVATRKGRIKIVELLLDNNETSPSTKAINRAGETPLDTAEK----TGHPQIAAVLKTRGVPSAKAINNTTRPNAARELKQTVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFAAIFTVPGQYADELSSLLPGQSLGEANIAD 412          
BLAST of HO067617 vs. TAIR peptide
Match: AT5G51160.1 (| Symbols: | Ankyrin repeat family protein | chr5:20792280-20793681 FORWARD LENGTH=442)

HSP 1 Score: 69.3218 bits (168), Expect = 1.529e-12
Identity = 55/171 (32.16%), Postives = 88/171 (51.46%), Query Frame = 2
Query:    8 SVVEEILQADP-TILNERDKKGNTALHMAT-RKSRSQIVILLLSY----ASLDVNAINKQQETALDLADKLPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPG 502
            ++VE I + +   +LN++D++GNTALH+AT RK+R  I +L+ +      S +VNA+NK   +A+DL    P      EI E L E GA+  R +G       ++RT S    + ++   Q+ K   +     K     HR++     +++ VVA L A+  F A    PG
Sbjct:  133 AIVELITETNRFDVLNKKDEQGNTALHLATWRKNRQVIEVLVQAIPEESRSFEVNAMNKMGLSAMDLLVMFPSEAGDREIYEKLIEAGAQRGRDIG----TTNVERTTSTSTCQERTMKSQSHKELVKYFTFKK-----HRDSPSEARSALLVVASLVATATFQASLTPPG 294          
BLAST of HO067617 vs. TAIR peptide
Match: AT5G54710.1 (| Symbols: | Ankyrin repeat family protein | chr5:22227665-22230500 REVERSE LENGTH=598)

HSP 1 Score: 65.855 bits (159), Expect = 1.690e-11
Identity = 53/167 (31.74%), Postives = 87/167 (52.10%), Query Frame = 2
Query:   44 ILNERDKKGNTALHMATRKSRSQIVILLLSYASLDVNAINKQQETALDLADK--LPYGTSALEIQEALAEYGAKYARHVGKVGEAMELKRTVSDIKHEVQSQLIQNEKTRRRVSGIAKELKKLHREAVQNTINSVTVVAVLFASIAFLAIFNLPGQYITKGSETGKS 538
            +L   D + NT LH+A     + +V  +LS  ++DV   NK+   A+DL DK  + +   +L  ++  AE   + AR+V    E +EL R  ++   ++ S+    +  R       KE +++H E++QN  N++T+VAVL AS+AF    N PG     G   GK+
Sbjct:  296 LLYSLDAEDNTVLHVAASVDSTSLVRHILSETTIDVTLKNKKGFAAVDLIDKEGVDFPLLSLWFRDE-AEKIQRPARYVKFAHEPVELIRNTNN-GEKLSSESRAMDLLREGRDPRNKE-REMHSESLQNARNTITIVAVLIASVAFTCGINPPGGVHQDGPFIGKA 459          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 3
Match NameE-valueIdentityDescription
Y2168_ARATH3.018e-7075.98Ankyrin repeat-containing protein At2g01680 OS=Ara... [more]
Y5262_ARATH1.083e-3545.40Ankyrin repeat-containing protein At5g02620 OS=Ara... [more]
Y3236_ARATH1.415e-3547.40Ankyrin repeat-containing protein At3g12360 OS=Ara... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
A9PDX2_POPTR3.388e-7681.52Putative uncharacterized protein OS=Populus tricho... [more]
B9HW17_POPTR2.196e-7580.98Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9HJG3_POPTR4.893e-7580.43Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9SJ26_RICCO3.506e-7378.26Ankyrin repeat-containing protein, putative OS=Ric... [more]
D7T8L5_VITVI1.247e-7077.47Whole genome shotgun sequence of line PN40024, sca... [more]
B6TEZ8_MAIZE8.102e-6269.02Protein binding protein OS=Zea mays PE=2 SV=1[more]
A3AB47_ORYSJ4.021e-6168.11Putative uncharacterized protein OS=Oryza sativa s... [more]
A2X9C6_ORYSI4.021e-6168.11Putative uncharacterized protein OS=Oryza sativa s... [more]
Q6Z750_ORYSJ1.528e-6067.57Ankyrin-like protein OS=Oryza sativa subsp. japoni... [more]
C5XZ99_SORBI3.404e-6068.11Putative uncharacterized protein Sb04g028680 OS=So... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT2G01680.13.239e-7175.98| Symbols: | Ankyrin repeat family protein | chr2... [more]
AT1G07710.12.264e-4050.80| Symbols: | Ankyrin repeat family protein | chr1... [more]
AT2G31820.11.373e-3747.83| Symbols: | Ankyrin repeat family protein | chr2... [more]
AT1G05640.11.373e-3751.50| Symbols: | Ankyrin repeat family protein | chr1... [more]
AT5G02620.11.163e-3645.40| Symbols: ANK1, ATANK1 | ankyrin-like1 | chr5:589... [more]
AT3G12360.11.518e-3647.40| Symbols: ITN1 | Ankyrin repeat family protein | ... [more]
AT3G09550.12.590e-3648.19| Symbols: | Ankyrin repeat family protein | chr3... [more]
AT5G60070.13.740e-3547.64| Symbols: | ankyrin repeat family protein | chr5... [more]
AT5G51160.11.529e-1232.16| Symbols: | Ankyrin repeat family protein | chr5... [more]
AT5G54710.11.690e-1131.74| Symbols: | Ankyrin repeat family protein | chr5... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 23..54
score: 8.5
IPR002110Ankyrin repeatPROFILEPS50088ANK_REPEATcoord: 22..55
score: 9
IPR020683Ankyrin repeat-containing domainGENE3D1.25.40.20no descriptioncoord: 4..90
score: 4.2
IPR020683Ankyrin repeat-containing domainPROFILEPS50297ANK_REP_REGIONcoord: 1..64
score: 12
IPR020683Ankyrin repeat-containing domainSUPERFAMILY48403Ankyrin repeatcoord: 2..87
score: 1.9
NoneNo IPR availablePANTHERPTHR18958ANKYRIN REPEAT-CONTAININGcoord: 2..175
score: 8.5
NoneNo IPR availablePANTHERPTHR18958:SF119ANK REPEAT-CONTAININGcoord: 2..175
score: 8.5

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO067617 ID=HO067617|Name=HO067617|organism=Cicer arietinum|type=EST|length=558bp
AGGTACATCAGTGGTGGAGGAGATATTACAGGCTGATCCTACTATATTGA
ACGAACGAGATAAGAAGGGTAACACAGCTCTTCACATGGCTACGAGGAAA
AGCCGTTCGCAGATAGTGATCCTTTTGCTAAGCTATGCATCTTTGGATGT
TAATGCCATCAATAAGCAGCAAGAAACAGCCTTGGATTTAGCAGATAAAC
TTCCATATGGAACTTCAGCTTTAGAAATCCAAGAAGCCCTCGCAGAATAC
GGTGCCAAATATGCAAGACATGTTGGTAAAGTGGGTGAAGCTATGGAACT
TAAAAGAACAGTAAGTGACATAAAGCATGAGGTTCAGTCACAACTCATAC
AAAACGAAAAAACTCGGCGACGAGTTTCTGGCATAGCTAAGGAATTGAAG
AAACTTCATAGAGAAGCCGTTCAAAACACCATTAACTCAGTCACAGTGGT
CGCAGTCCTTTTCGCCTCAATAGCATTCTTGGCTATATTCAATTTGCCCG
GTCAATATATAACTAAAGGATCAGAGACAGGAAAATCTAACATAGCTGAT
CATGTAGG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom