FE671015
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE671015 vs. TrEMBL
Match: A2Q3H3_MEDTR (Peptidase, cysteine peptidase active site OS=Medicago truncatula GN=MtrDRAFT_AC155882g19v2 PE=4 SV=1) HSP 1 Score: 94.7449 bits (234), Expect = 5.579e-18 Identity = 45/50 (90.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFLIAYLVGILPKGYT+S LD +MKEGSLNIQAGTAFVDFEF+EEV Sbjct: 185 HEAGHFLIAYLVGILPKGYTLSSLDGMMKEGSLNIQAGTAFVDFEFLEEV 234
BLAST of FE671015 vs. TrEMBL
Match: B9REY8_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1429740 PE=4 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 1.623e-17 Identity = 44/50 (88.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFLIAYLVGILPKGYT+S L+AL KEGSLN+QAGTAFVDFEF+EEV Sbjct: 182 HEAGHFLIAYLVGILPKGYTLSSLEALQKEGSLNVQAGTAFVDFEFLEEV 231
BLAST of FE671015 vs. TrEMBL
Match: Q2KP22_9SOLN (Stress regulated protein isoform 3 OS=Solanum virginianum PE=2 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 3.616e-17 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFLIAYL+GILPKGYT++ LDAL K+GSLNIQAGTAFVDFEF+EEV Sbjct: 171 HEAGHFLIAYLLGILPKGYTLTSLDALKKQGSLNIQAGTAFVDFEFIEEV 220
BLAST of FE671015 vs. TrEMBL
Match: D7TUZ3_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_30.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00022011001 PE=4 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 6.169e-17 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFLIAYL+GILPKGYT++ L+AL KEGSLNIQAGTAFVDFEF+EEV Sbjct: 177 HEAGHFLIAYLLGILPKGYTLTSLEALQKEGSLNIQAGTAFVDFEFLEEV 226
BLAST of FE671015 vs. TrEMBL
Match: A5BCW9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_030170 PE=4 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 6.169e-17 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFLIAYL+GILPKGYT++ L+AL KEGSLNIQAGTAFVDFEF+EEV Sbjct: 165 HEAGHFLIAYLLGILPKGYTLTSLEALQKEGSLNIQAGTAFVDFEFLEEV 214
BLAST of FE671015 vs. TrEMBL
Match: Q2KP21_SOLLC (Stress regulated protein OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 90.8929 bits (224), Expect = 8.057e-17 Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFLIAYL+GILPKGYT++ LDAL KEGSLNIQAGTAFVD EF+EEV Sbjct: 171 HEAGHFLIAYLLGILPKGYTLTSLDALKKEGSLNIQAGTAFVDLEFIEEV 220
BLAST of FE671015 vs. TrEMBL
Match: O04645_ARATH (A_TM021B04.11 protein OS=Arabidopsis thaliana GN=A_TM021B04.11 PE=4 SV=1) HSP 1 Score: 90.1225 bits (222), Expect = 1.374e-16 Identity = 41/58 (70.69%), Postives = 51/58 (87.93%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEVGCFICSIY 178 HEAGHFL+AYLVGILP+GYT+S L+AL KEGSLNIQAG+AFVD+EF+EE +C ++ Sbjct: 202 HEAGHFLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEPNKKLCLLF 259
BLAST of FE671015 vs. TrEMBL
Match: Q2V343_ARATH (Putative uncharacterized protein At5g27290.2 OS=Arabidopsis thaliana GN=At5g27290 PE=4 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 2.344e-16 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFL+AYLVGILP+GYT+S L+AL KEGSLNIQAG+AFVD+EF+EEV Sbjct: 186 HEAGHFLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEV 235
BLAST of FE671015 vs. TrEMBL
Match: Q08AA8_ARATH (At5g27290 OS=Arabidopsis thaliana GN=At5g27290 PE=2 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 2.344e-16 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFL+AYLVGILP+GYT+S L+AL KEGSLNIQAG+AFVD+EF+EEV Sbjct: 186 HEAGHFLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEV 235
BLAST of FE671015 vs. TrEMBL
Match: D7M667_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_910860 PE=4 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 2.344e-16 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFL+AYLVGILP+GYT+S L+AL KEGSLNIQAG+AFVD+EF+EEV Sbjct: 186 HEAGHFLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEV 235
BLAST of FE671015 vs. TAIR peptide
Match: AT5G27290.2 (| Symbols: | unknown protein; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G54680.3); Has 199 Blast hits to 194 proteins in 57 species: Archae - 0; Bacteria - 61; Metazoa - 0; Fungi - 0; Plants - 129; Viruses - 0; Other Eukaryotes - 9 (source: NCBI BLink). | chr5:9618787-9620473 REVERSE LENGTH=262) HSP 1 Score: 89.3521 bits (220), Expect = 1.715e-18 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFL+AYLVGILP+GYT+S L+AL KEGSLNIQAG+AFVD+EF+EEV Sbjct: 186 HEAGHFLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEV 235
BLAST of FE671015 vs. TAIR peptide
Match: AT5G27290.1 (| Symbols: | unknown protein; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G54680.3); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:9618590-9620473 REVERSE LENGTH=341) HSP 1 Score: 89.3521 bits (220), Expect = 1.715e-18 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEV 154 HEAGHFL+AYLVGILP+GYT+S L+AL KEGSLNIQAG+AFVD+EF+EEV Sbjct: 186 HEAGHFLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFVDYEFLEEV 235
BLAST of FE671015 vs. TAIR peptide
Match: AT1G54680.2 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G27290.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr1:20413337-20414482 FORWARD LENGTH=219) HSP 1 Score: 52.7582 bits (125), Expect = 1.779e-7 Identity = 23/51 (45.10%), Postives = 36/51 (70.59%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEVG 157 HE+GHFL+ YL+G+LP+ Y + L+A+ + S N+ FV FEF+++VG Sbjct: 50 HESGHFLVGYLLGVLPRHYEIPTLEAVRQNVS-NVTGRVEFVGFEFLKQVG 99
BLAST of FE671015 vs. TAIR peptide
Match: AT1G54680.1 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G27290.1); Has 200 Blast hits to 200 proteins in 57 species: Archae - 0; Bacteria - 59; Metazoa - 0; Fungi - 0; Plants - 127; Viruses - 0; Other Eukaryotes - 14 (source: NCBI BLink). | chr1:20413211-20414482 FORWARD LENGTH=223) HSP 1 Score: 52.7582 bits (125), Expect = 1.779e-7 Identity = 23/51 (45.10%), Postives = 36/51 (70.59%), Query Frame = 2 Query: 5 HEAGHFLIAYLVGILPKGYTVSILDALMKEGSLNIQAGTAFVDFEFVEEVG 157 HE+GHFL+ YL+G+LP+ Y + L+A+ + S N+ FV FEF+++VG Sbjct: 54 HESGHFLVGYLLGVLPRHYEIPTLEAVRQNVS-NVTGRVEFVGFEFLKQVG 103 The following BLAST results are available for this feature:
BLAST of FE671015 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of FE671015 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE671015 ID=FE671015; Name=FE671015; organism=Cicer arietinum; type=EST; length=620bpback to top |