GR420856
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR420856 vs. TrEMBL
Match: C6T2Q1_SOYBN (50S ribosomal protein L34 OS=Glycine max PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.367e-10 Identity = 38/74 (51.35%), Postives = 45/74 (60.81%), Query Frame = -1 Query: 96 LGLTFNFGARRHNGRGCVGAGVARSAFCLTKRSKSLRSRTQHAGFRKRMSTPNGLF*RGCQGVDGRKVLCTKTH 317 L LT NFG RR G G V ++A CLTKRS+S +S + GFRKRMSTP G + GR+ LCTKTH Sbjct: 69 LDLTSNFGTRRGKGSGLV-VRAGKAALCLTKRSRSRKSLARTHGFRKRMSTPGGRAVLRRRRAKGRRALCTKTH 141
BLAST of GR420856 vs. TrEMBL
Match: C6T1Q9_SOYBN (50S ribosomal protein L34 OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.175e-9 Identity = 37/74 (50.00%), Postives = 45/74 (60.81%), Query Frame = -1 Query: 96 LGLTFNFGARRHNGRGCVGAGVARSAFCLTKRSKSLRSRTQHAGFRKRMSTPNGLF*RGCQGVDGRKVLCTKTH 317 L LT N G +R G G V ++A CLTKRS+S +S + GFRKRMSTP G + GR+VLCTKTH Sbjct: 69 LDLTSNVGTKRGKGSGLV-VRAGKAALCLTKRSRSRKSLARTHGFRKRMSTPGGRAVLRRRRAKGRRVLCTKTH 141
BLAST of GR420856 vs. TrEMBL
Match: B9I1N1_POPTR (50S ribosomal protein L34 (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_235374 PE=3 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.458e-7 Identity = 33/74 (44.59%), Postives = 44/74 (59.46%), Query Frame = -1 Query: 96 LGLTFNFGARRHNGRGCVGAGVARSAFCLTKRSKSLRSRTQHAGFRKRMSTPNGLF*RGCQGVDGRKVLCTKTH 317 L L N G R+ GRG V ++A CLTKRS+S +S + GFR+RM T +G + GRKVLCTK++ Sbjct: 54 LDLNSNIGVRKDIGRGLV-VRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSN 126 The following BLAST results are available for this feature:
BLAST of GR420856 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR420856 ID=GR420856; Name=GR420856; organism=Cicer arietinum; type=EST; length=347bpback to top |