HO063314

EST Overview
NameHO063314
Unique NameHO063314
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length758
Libraries
Library NameType
LIBEST_026410 Chickpea drought stressed cDNA SSH library AR1cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO063314 vs. SwissProt
Match: NUP3_PENSQ (Nuclease PA3 OS=Penicillium sp. PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.538e-22
Identity = 64/222 (28.83%), Postives = 101/222 (45.50%), Query Frame = 1
Query:   58 WSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDD---KCGFQYSRDCHEDMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCV---NNWAKESIQIAC 705
            W   GH     +AQ  + PEA+   Q +L    +  L+++  W D+ R     +W++ LHFID  D+    C   Y RDC    C   AI N+T ++S     +S    N  EAL FL HF GD+ QP+H       GGN I++ +  +  NLH  WD  +    +  +   D     + + +N  +G ++     W   + IS  +     WA ++  + C
Sbjct:    1 WGALGHATVAYVAQHYVSPEAASWAQGILGSSSSSYLASIASWADEYRLTSAGKWSASLHFIDAEDNPPTNCNVDYERDCGSSGCSISAIANYTQRVS----DSSLSSENHAEALRFLVHFIGDMTQPLH-DEAYAVGGNKINVTFDGYHDNLHSDWDTYMPQKLIGGHALSDAESWAKTLVQNIESGNYTAQATGWIKGDNISEPITTATRWASDANALVC 217          
BLAST of HO063314 vs. SwissProt
Match: NUP1_PENCI (Nuclease P1 OS=Penicillium citrinum PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 7.233e-22
Identity = 64/222 (28.83%), Postives = 101/222 (45.50%), Query Frame = 1
Query:   58 WSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDD---KCGFQYSRDCHEDMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCV---NNWAKESIQIAC 705
            W   GH     +AQ  + PEA+   Q +L    +  L+++  W D+ R     +W++ LHFID  D+    C   Y RDC    C   AI N+T ++S     +S    N  EAL FL HF GD+ QP+H       GGN I++ +  +  NLH  WD  +    +  +   D     + + +N  +G ++     W   + IS  +     WA ++  + C
Sbjct:    1 WGALGHATVAYVAQHYVSPEAASWAQGILGSSSSSYLASIASWADEYRLTSAGKWSASLHFIDAEDNPPTNCNVDYERDCGSSGCSISAIANYTQRVS----DSSLSSENHAEALRFLVHFIGDMTQPLH-DEAYAVGGNKINVTFDGYHDNLHSDWDTYMPQKLIGGHALSDAESWAKTLVQNIESGNYTAQAIGWIKGDNISEPITTATRWASDANALVC 217          
BLAST of HO063314 vs. SwissProt
Match: NUS1_ASPOR (Nuclease S1 OS=Aspergillus oryzae GN=nucS PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.044e-20
Identity = 63/222 (28.38%), Postives = 92/222 (41.44%), Query Frame = 1
Query:   58 WSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFI---DTPDDKCGFQYSRDCHEDMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNN---WAKESIQIAC 705
            W   GHE    IAQ+ +        Q +L       L+ +  W D  ++     ++ P HFI   D P   CG  Y RDC    C   AI+N+T+ L     G+         AL F+ H  GDIHQP+H     + GGN ID+ +    +NLHH+WD  +   +   Y           + +    G +S    SW +   I   V+    WA ++    C
Sbjct:   21 WGNLGHETVAYIAQSFVASSTESFCQNILGDDSTSYLANVATWADTYKYTDAGEFSKPYHFIDAQDNPPQSCGVDYDRDCGSAGCSISAIQNYTNILLESPNGS-----EALNALKFVVHIIGDIHQPLH-DENLEAGGNGIDVTYDGETTNLHHIWDTNMPEEAAGGYSLSVAKTYADLLTERIKTGTYSSKKDSWTDGIDIKDPVSTSMIWAADANTYVC 236          
BLAST of HO063314 vs. TrEMBL
Match: A5A338_SOYBN (Endonuclease OS=Glycine max GN=EN1 PE=2 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 8.957e-124
Identity = 200/244 (81.97%), Postives = 223/244 (91.39%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCH-----EDMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            VPG +AWSKEGH MTCQIAQALL+PEASEAV QLLP +V GNLSALC WPDQIRHWYKYRWTSPLHFIDTPD+ C FQYSRDCH     EDMCVAGA+KNFTSQL HYKEGTSDRRYNMTEALLFL+HF GDIHQPMHVGFT+D+GGN+I+LRW+RHKSNLHHVWDREIILT L+DYYDKDV+ LLQDIE+NYT+GIWSDDV SW++CN IS+CVNNWAKESIQIAC+WGY+GV+ G TLA++Y
Sbjct:   27 VPGALAWSKEGHVMTCQIAQALLEPEASEAVYQLLPDHVKGNLSALCTWPDQIRHWYKYRWTSPLHFIDTPDNACSFQYSRDCHDPQGVEDMCVAGAVKNFTSQLMHYKEGTSDRRYNMTEALLFLSHFMGDIHQPMHVGFTTDEGGNTIELRWFRHKSNLHHVWDREIILTGLADYYDKDVSFLLQDIERNYTDGIWSDDVTSWKHCNDISQCVNNWAKESIQIACKWGYEGVQPGTTLADDY 270          
BLAST of HO063314 vs. TrEMBL
Match: B4ERM5_HUMLU (Putative pre-endonuclease OS=Humulus lupulus GN=hbn1 PE=2 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 2.703e-112
Identity = 181/244 (74.18%), Postives = 214/244 (87.70%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCH-----EDMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            VP    WSKEGH MTCQIAQALL  EA+EAV+ LLP YVNG+LSALCVWPDQ+RHWY+YRWTSPLHFIDTPD  C F YSRDCH     E+MCVAGAI+NFTSQLSHY+EGTSDRRYNMTEALLFL+HF GDIHQP+HVGFT+D+GGN+I+LRW+RHKSNLHHVWDREIILT+L DYY+K+  LLLQDI+ NYT+G+WSDDV+SWE+C+ ++ C+N +A ESI IAC+WGY+ VE G+TLA++Y
Sbjct:   19 VPSAHGWSKEGHTMTCQIAQALLDSEAAEAVRNLLPDYVNGDLSALCVWPDQVRHWYRYRWTSPLHFIDTPDQACSFDYSRDCHDQHGLENMCVAGAIQNFTSQLSHYREGTSDRRYNMTEALLFLSHFMGDIHQPLHVGFTTDEGGNTINLRWFRHKSNLHHVWDREIILTALKDYYEKNTDLLLQDIKGNYTDGVWSDDVSSWEHCDDLASCINKFAVESINIACKWGYKDVEPGVTLADDY 262          
BLAST of HO063314 vs. TrEMBL
Match: D7SSG6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_301.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00005841001 PE=4 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 1.483e-110
Identity = 178/243 (73.25%), Postives = 211/243 (86.83%), Query Frame = 1
Query:   43 PGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            PG +AWSKEGH MTCQIAQALL+PEA+EAV+ LLP YVNG+LSALC WPDQIRHWYKYRWTS LHFIDTPD+ C F YSRDCH+     DMCVAGAIKNFTSQLSHY EG+SDRRYN+TEALLFL+HF GDIHQP+HVGFTSD+GGN+I+L W+RHKSNLHHVWDREIILT+ +D+Y KD+ LLL+DI+ N+T+G+W+DDV+SW+ CN +  C N +A ESI IAC+WGY+G + G TLA+EY
Sbjct:    3 PGALAWSKEGHIMTCQIAQALLEPEAAEAVRNLLPDYVNGDLSALCTWPDQIRHWYKYRWTSSLHFIDTPDEACTFDYSRDCHDPHGLQDMCVAGAIKNFTSQLSHYGEGSSDRRYNLTEALLFLSHFMGDIHQPLHVGFTSDEGGNTIELHWFRHKSNLHHVWDREIILTAAADFYTKDMDLLLEDIKGNFTDGVWADDVSSWKECNDLLTCPNKYASESISIACKWGYKGAKPGSTLADEY 245          
BLAST of HO063314 vs. TrEMBL
Match: Q0KFV0_SOLLC (Putative endonuclease OS=Solanum lycopersicum GN=tbn1 PE=2 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.937e-110
Identity = 180/242 (74.38%), Postives = 206/242 (85.12%), Query Frame = 1
Query:   46 GVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            GV AWSKEGH MTC+IAQ LL  EA+ AV+ LLP YVNG+LSALCVWPDQ+RHWYKY+WTSPLHFIDTPD  C F Y RDCH+     DMCVAGAI+NFT+QLSHY+EGTSDRRYNMTEALLFL+HF GDIHQPMHVGFTSD GGNSIDLRW+RHKSNLHHVWDREIILT+  DYY KD+ LL +DIE N+T+GIWSDD+ASW  C  +  CVN +A ESI IAC+WGY+GVE+G TL+++Y
Sbjct:   22 GVEAWSKEGHVMTCRIAQGLLNDEAAHAVKMLLPEYVNGDLSALCVWPDQVRHWYKYKWTSPLHFIDTPDKACNFDYERDCHDQHGVKDMCVAGAIQNFTTQLSHYREGTSDRRYNMTEALLFLSHFMGDIHQPMHVGFTSDAGGNSIDLRWFRHKSNLHHVWDREIILTAAKDYYAKDINLLEEDIEGNFTDGIWSDDLASWRECGNVFSCVNKFATESINIACKWGYKGVEAGETLSDDY 263          
BLAST of HO063314 vs. TrEMBL
Match: O80326_ZINEL (Endonuclease OS=Zinnia elegans GN=ZEN1 PE=2 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 2.530e-110
Identity = 179/241 (74.27%), Postives = 210/241 (87.14%), Query Frame = 1
Query:   49 VIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            V AWSKEGH MTCQIAQ LL P+A+ AVQ LLP YV GNLSALCVWPDQIRHWY+YRWTSPLHFIDTPDD C F Y+RDCH+     DMCVAGAIKNFTSQLSHY+ GTSDRRYNMTEALLF++HF GDIHQPMHVGFT+D+GGN+IDLRW+RHKSNLHHVWDREIILT+ S+ YDKD+  L + I+ N+T+G+WSDDV SW++C+ IS CVN +AKESI +AC+WGY+GVE+G TL+++Y
Sbjct:   23 VQAWSKEGHVMTCQIAQELLSPDAAHAVQMLLPDYVKGNLSALCVWPDQIRHWYRYRWTSPLHFIDTPDDACSFDYTRDCHDSNGMVDMCVAGAIKNFTSQLSHYQHGTSDRRYNMTEALLFVSHFMGDIHQPMHVGFTTDEGGNTIDLRWFRHKSNLHHVWDREIILTAASELYDKDMESLQKAIQANFTHGLWSDDVNSWKDCDDISNCVNKYAKESIALACKWGYEGVEAGETLSDDY 263          
BLAST of HO063314 vs. TrEMBL
Match: Q6B782_SOLTU (Endonuclease OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 4.316e-110
Identity = 180/242 (74.38%), Postives = 205/242 (84.71%), Query Frame = 1
Query:   46 GVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            G  AWSKEGH MTC+IAQ LL  EA+ AV+ LLP YVNG+LSALCVWPDQ+RHWYKY+WTSPLHFIDTPD  C F Y RDCH+     DMCVAGAI+NFT+QLSHY+EGTSDRRYNMTEALLFL+HF GDIHQPMHVGFTSD GGNSIDLRW+RHKSNLHHVWDREIILT+  DYY KDV LL +DIE N+T+GIWSDD+ASW  C  +  CVN +A ESI IAC+WGY+GVE+G TL+++Y
Sbjct:   22 GAEAWSKEGHMMTCRIAQGLLNDEAAHAVKMLLPEYVNGDLSALCVWPDQVRHWYKYKWTSPLHFIDTPDKACNFDYERDCHDQHGVKDMCVAGAIQNFTTQLSHYREGTSDRRYNMTEALLFLSHFMGDIHQPMHVGFTSDAGGNSIDLRWFRHKSNLHHVWDREIILTAAKDYYAKDVNLLEEDIEGNFTDGIWSDDLASWRECGNVFSCVNKFATESINIACKWGYKGVEAGETLSDDY 263          
BLAST of HO063314 vs. TrEMBL
Match: Q52PK8_DIACA (Putative nuclease (Fragment) OS=Dianthus caryophyllus PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.388e-108
Identity = 173/244 (70.90%), Postives = 208/244 (85.25%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            + GV  WSKEGH +TCQIAQ LL+PEA  AV+ L+P ++NGNLSALCVWPDQ+RHWYKYRWTSPLHFID PDD C F Y RDCH+     DMCVAGAI+N+TSQL HY+EG+SDRRYNMTEALLFL+HF GDIHQPMH G T+D+GGN+I+LRW++HKSNLHHVWDREIILT++ DYYDKDVTLL QDIE N+T+GIW++DV+SW +C  +  CV  +A ESI IAC+WGY+GVE G+TL++EY
Sbjct:    7 IVGVRGWSKEGHTITCQIAQNLLEPEALHAVKNLIPEHLNGNLSALCVWPDQVRHWYKYRWTSPLHFIDAPDDSCSFNYDRDCHDSHGVKDMCVAGAIQNYTSQLQHYREGSSDRRYNMTEALLFLSHFMGDIHQPMHCGHTTDEGGNTIELRWFKHKSNLHHVWDREIILTAMKDYYDKDVTLLQQDIEGNFTDGIWANDVSSWTDCESLHACVTKYATESINIACKWGYKGVEPGVTLSDEY 250          
BLAST of HO063314 vs. TrEMBL
Match: Q9LL59_APIGR (CEL I mismatch endonuclease OS=Apium graveolens PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.813e-108
Identity = 178/243 (73.25%), Postives = 204/243 (83.95%), Query Frame = 1
Query:   43 PGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            PGV AWSKEGH MTCQIAQ LL+PEA+ AV+ LLP Y NGNLS+LCVWPDQIRHWYKYRWTS LHFIDTPD  C F Y RDCH+     DMCVAGAI+NFTSQL H++ GTSDRRYNMTEALLFL+HF GDIHQPMHVGFTSD GGNSIDLRW+RHKSNLHHVWDREIILT+ +DY+ KD+  LLQDI++N+T G W  DV SW+ C+ IS C N +AKESI++AC WGY+ VESG TL+++Y
Sbjct:   18 PGVRAWSKEGHVMTCQIAQDLLEPEAAHAVKMLLPDYANGNLSSLCVWPDQIRHWYKYRWTSSLHFIDTPDQACSFDYQRDCHDPHGGKDMCVAGAIQNFTSQLGHFRHGTSDRRYNMTEALLFLSHFMGDIHQPMHVGFTSDMGGNSIDLRWFRHKSNLHHVWDREIILTAAADYHGKDMHSLLQDIQRNFTEGSWLQDVESWKECDDISTCANKYAKESIKLACNWGYKDVESGETLSDKY 260          
BLAST of HO063314 vs. TrEMBL
Match: B9S605_RICCO (Nuclease PA3, putative OS=Ricinus communis GN=RCOM_1062930 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 2.005e-107
Identity = 175/239 (73.22%), Postives = 204/239 (85.36%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHEDMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            VPG + WSKEGH MTC+IAQ LL PEA+ AV+ LLP  VNG+LSALCVW DQIRHWYKYRWTS LHFIDTPD  C F YSRDC ED CVAGAI+NFTSQL HYKEG++DRRYN+TEALLFL+HF GDIHQP+HVGFTSD+GGN+IDLRWYRHKSNLHHVWDREIILT+L DYY+ D+ LL Q IE N+T+GIW DDV+SW++C+ I  C N +A ESI IAC+WGY+GV+ G TL+++Y
Sbjct:   10 VPGALGWSKEGHIMTCRIAQNLLGPEAAHAVEHLLPHNVNGDLSALCVWADQIRHWYKYRWTSSLHFIDTPDKACTFDYSRDCEEDRCVAGAIQNFTSQLLHYKEGSTDRRYNLTEALLFLSHFVGDIHQPLHVGFTSDEGGNTIDLRWYRHKSNLHHVWDREIILTALKDYYENDMNLLQQAIEGNFTDGIWYDDVSSWKDCSDILSCPNKYAAESISIACKWGYKGVKGGATLSDDY 248          
BLAST of HO063314 vs. TrEMBL
Match: A0MSM3_SPIOL (SP I mismatch endonuclease OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 6.449e-106
Identity = 171/244 (70.08%), Postives = 203/244 (83.20%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCH-----EDMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            + GV AWSKEGH +TC+IAQ LL+PEA++AV++LLP  +NGNLSALCVWPDQ+RHWYKYRWTSPLHFIDTPDD C F Y RDCH     EDMCVAGAI+NFTSQL HY++GT+DRRYN+TEALLFL+HF GDIHQPMH   TSD+GGNSIDLRW+RHKSNLHHVWDREIILT++ DYYD DV LL QDI  N+T+GIW DDV+ W +C+ +  CV  +A ESI IAC+WGY+  + G+TL + Y
Sbjct:   18 IAGVQAWSKEGHMITCKIAQDLLEPEAADAVKKLLPEDLNGNLSALCVWPDQVRHWYKYRWTSPLHFIDTPDDSCSFDYKRDCHDEHGVEDMCVAGAIQNFTSQLQHYRQGTADRRYNLTEALLFLSHFMGDIHQPMHCAHTSDRGGNSIDLRWFRHKSNLHHVWDREIILTAMKDYYDNDVDLLQQDIVGNFTDGIWFDDVSHWTDCDSLHTCVTKYATESINIACKWGYKDADPGVTLGDNY 261          
BLAST of HO063314 vs. TAIR peptide
Match: AT1G11190.1 (| Symbols: BFN1, ENDO1 | bifunctional nuclease i | chr1:3750338-3752696 REVERSE LENGTH=305)

HSP 1 Score: 379.407 bits (973), Expect = 1.154e-105
Identity = 169/244 (69.26%), Postives = 203/244 (83.20%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            V  V +WSKEGH +TC+IAQ LL+   +  V+ LLP YV G+LSALCVWPDQIRHWYKYRWTS LH+IDTPD  C ++YSRDCH+     DMCV GAI+NFTSQL HY EGTSDRRYNMTEALLFL+HF GDIHQPMHVGFTSD+GGN+IDLRWY+HKSNLHHVWDREIILT+L + YDK++ LL +D+EKN TNG+W DD++SW  CN +  C + +A ESI++AC+WGY+GV+SG TL+EEY
Sbjct:   23 VSSVRSWSKEGHILTCRIAQNLLEAGPAHVVENLLPDYVKGDLSALCVWPDQIRHWYKYRWTSHLHYIDTPDQACSYEYSRDCHDQHGLKDMCVDGAIQNFTSQLQHYGEGTSDRRYNMTEALLFLSHFMGDIHQPMHVGFTSDEGGNTIDLRWYKHKSNLHHVWDREIILTALKENYDKNLDLLQEDLEKNITNGLWHDDLSSWTECNDLIACPHKYASESIKLACKWGYKGVKSGETLSEEY 266          
BLAST of HO063314 vs. TAIR peptide
Match: AT4G21585.1 (| Symbols: ENDO4 | endonuclease 4 | chr4:11477988-11479953 FORWARD LENGTH=299)

HSP 1 Score: 266.929 bits (681), Expect = 8.348e-72
Identity = 118/246 (47.97%), Postives = 171/246 (69.51%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDR-RYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCN-GISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            + G + W KEGH   C+IA++  + E   AV++LLP   +G+L+++C WPD+I+H +++RWTSPLH++DTPD +C ++Y RDCH+     D CV GAI N+T QL    E +     YN+TEAL+FL+HF GDIHQP+HVGF  D+GGN+I +RWYR K+NLHHVWD  II ++L  YY+K + L+++ ++ N TN  WS+DV  WE+C    + C N +A ESI +AC++ Y+    G TL ++Y
Sbjct:   19 INGALCWGKEGHYTVCKIAESYFEEETVAAVKKLLPKSADGDLASVCSWPDEIKHHWQWRWTSPLHYVDTPDYRCNYEYCRDCHDTHKNQDRCVTGAIFNYTMQLMSASENSDTIVHYNLTEALMFLSHFIGDIHQPLHVGFLGDEGGNTITVRWYRRKTNLHHVWDNMIIESALKTYYNKSLPLMIEALQANLTND-WSNDVPLWESCQLNQTACPNPYASESINLACKYAYRNATPGTTLGDDY 263          
BLAST of HO063314 vs. TAIR peptide
Match: AT1G68290.1 (| Symbols: ENDO 2 | endonuclease 2 | chr1:25596718-25598264 FORWARD LENGTH=290)

HSP 1 Score: 255.758 bits (652), Expect = 1.925e-68
Identity = 118/244 (48.36%), Postives = 168/244 (68.85%), Query Frame = 1
Query:   43 PGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHEDM-----CVAGAIKNFTSQLSHYKEGTSDR-RYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            P +  W KEGHE+ C+IAQ  L   A++AV++LLP    G+LS+LC+W D+++  ++Y W+SPLH+I+TPD  C +QY+RDC ++      CVAGAI N+T+QL  YK   S + +YN+TEALLF++HF GDIHQP+HV + SDKGGN+I++ WY  K+NLHH+WD  II T+ +D Y+  +  ++  ++KN T   W+D V  WE C   + C + +A E IQ AC W Y+GV  G TL +EY
Sbjct:   23 PNIHGWGKEGHEIICKIAQTRLDETAAKAVKELLPESAEGDLSSLCLWADRVK--FRYHWSSPLHYINTPD-ACSYQYNRDCKDESGEKGRCVAGAIYNYTTQLLSYKTAASSQSQYNLTEALLFVSHFMGDIHQPLHVSYASDKGGNTIEVHWYTRKANLHHIWDSNIIETAEADLYNSALEGMVDALKKNITTE-WADQVKRWETCTKKTACPDIYASEGIQAACDWAYKGVTEGDTLEDEY 262          
BLAST of HO063314 vs. TAIR peptide
Match: AT4G21590.2 (| Symbols: ENDO3 | endonuclease 3 | chr4:11480524-11482574 FORWARD LENGTH=294)

HSP 1 Score: 244.588 bits (623), Expect = 4.437e-65
Identity = 112/241 (46.47%), Postives = 158/241 (65.56%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHEDMCVAGAIKNFTSQLSHYKEGT-SDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCN-GISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            V G + W   GH   C+IAQ+  + +   AV++LLP   NG L+A+C WPD+I+   ++RWTS LHF DTPD KC ++YSRDC +D CV GAI N+T+QL    E + S   YN+TEAL+FL+H+ GDIHQP+H GF  D GGN I + WY  ++NLH VWD  II ++L  YY+  +  ++ +++    NG WS+DV SWE+C    + C N +A ESI +AC++ Y+   +G TL + Y
Sbjct:   19 VNGALCWGDAGHYAVCKIAQSYFEEDTVVAVKKLLPESANGELAAVCSWPDEIKKLPQWRWTSALHFADTPDYKCNYEYSRDCPKDWCVTGAIFNYTNQLMSTSENSQSIVHYNLTEALMFLSHYMGDIHQPLHEGFIGDLGGNKIKVHWYNQETNLHRVWDDMIIESALETYYNSSLPRMIHELQAKLKNG-WSNDVPSWESCQLNQTACPNPYASESIDLACKYAYRNATAGTTLGDYY 258          
BLAST of HO063314 vs. TAIR peptide
Match: AT4G21590.1 (| Symbols: ENDO3 | endonuclease 3 | chr4:11480524-11482574 FORWARD LENGTH=294)

HSP 1 Score: 244.588 bits (623), Expect = 4.437e-65
Identity = 112/241 (46.47%), Postives = 158/241 (65.56%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGNLSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHEDMCVAGAIKNFTSQLSHYKEGT-SDRRYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCN-GISRCVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            V G + W   GH   C+IAQ+  + +   AV++LLP   NG L+A+C WPD+I+   ++RWTS LHF DTPD KC ++YSRDC +D CV GAI N+T+QL    E + S   YN+TEAL+FL+H+ GDIHQP+H GF  D GGN I + WY  ++NLH VWD  II ++L  YY+  +  ++ +++    NG WS+DV SWE+C    + C N +A ESI +AC++ Y+   +G TL + Y
Sbjct:   19 VNGALCWGDAGHYAVCKIAQSYFEEDTVVAVKKLLPESANGELAAVCSWPDEIKKLPQWRWTSALHFADTPDYKCNYEYSRDCPKDWCVTGAIFNYTNQLMSTSENSQSIVHYNLTEALMFLSHYMGDIHQPLHEGFIGDLGGNKIKVHWYNQETNLHRVWDDMIIESALETYYNSSLPRMIHELQAKLKNG-WSNDVPSWESCQLNQTACPNPYASESIDLACKYAYRNATAGTTLGDYY 258          
BLAST of HO063314 vs. TAIR peptide
Match: AT4G21600.1 (| Symbols: ENDO5 | endonuclease 5 | chr4:11485319-11487235 FORWARD LENGTH=296)

HSP 1 Score: 236.884 bits (603), Expect = 9.251e-63
Identity = 108/247 (43.72%), Postives = 163/247 (65.99%), Query Frame = 1
Query:   40 VPGVIAWSKEGHEMTCQIAQALLKPEASEAVQQLLPPYVNGN-LSALCVWPDQIRHWYKYRWTSPLHFIDTPDDKCGFQYSRDCHE-----DMCVAGAIKNFTSQLSHYKEGTSDR-RYNMTEALLFLAHFTGDIHQPMHVGFTSDKGGNSIDLRWYRHKSNLHHVWDREIILTSLSDYYDKDVTLLLQDIEKNYTNGIWSDDVASWENCNGISR-CVNNWAKESIQIACRWGYQGVESGMTLAEEY 756
            V G + W K+GH   C++A+   + +   AV++LLP  V+G  L+  C WPD+I+   +++WTS LH+++TP+ +C ++Y RDCH+     D CV GAI N+T+QL    E + +   YN+TEALLFL+H+ GD+HQP+H GF  D GGN+I + WY +KSNLHHVWD  II ++L  YY+  +  ++Q ++    NG WS+DV SW++C+   + C N +A ESI +AC++ Y+    G TL +EY
Sbjct:   15 VHGALCWGKDGHYTVCKLAEGFFEDDTIAAVKKLLPESVDGGGLADFCSWPDEIKKLSQWQWTSTLHYVNTPEYRCNYEYCRDCHDTHKHKDWCVTGAIFNYTNQLMSASENSQNIVHYNLTEALLFLSHYMGDVHQPLHTGFLGDLGGNTIIVNWYHNKSNLHHVWDNMIIDSALETYYNSSLPHMIQALQAKLKNG-WSNDVPSWKSCHFHQKACPNLYASESIDLACKYAYRNATPGTTLGDEY 260          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 3
Match NameE-valueIdentityDescription
NUP3_PENSQ5.538e-2228.83Nuclease PA3 OS=Penicillium sp. PE=1 SV=1[more]
NUP1_PENCI7.233e-2228.83Nuclease P1 OS=Penicillium citrinum PE=1 SV=1[more]
NUS1_ASPOR1.044e-2028.38Nuclease S1 OS=Aspergillus oryzae GN=nucS PE=1 SV=... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
A5A338_SOYBN8.957e-12481.97Endonuclease OS=Glycine max GN=EN1 PE=2 SV=1[more]
B4ERM5_HUMLU2.703e-11274.18Putative pre-endonuclease OS=Humulus lupulus GN=hb... [more]
D7SSG6_VITVI1.483e-11073.25Whole genome shotgun sequence of line PN40024, sca... [more]
Q0KFV0_SOLLC1.937e-11074.38Putative endonuclease OS=Solanum lycopersicum GN=t... [more]
O80326_ZINEL2.530e-11074.27Endonuclease OS=Zinnia elegans GN=ZEN1 PE=2 SV=1[more]
Q6B782_SOLTU4.316e-11074.38Endonuclease OS=Solanum tuberosum PE=2 SV=1[more]
Q52PK8_DIACA1.388e-10870.90Putative nuclease (Fragment) OS=Dianthus caryophyl... [more]
Q9LL59_APIGR1.813e-10873.25CEL I mismatch endonuclease OS=Apium graveolens PE... [more]
B9S605_RICCO2.005e-10773.22Nuclease PA3, putative OS=Ricinus communis GN=RCOM... [more]
A0MSM3_SPIOL6.449e-10670.08SP I mismatch endonuclease OS=Spinacia oleracea PE... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 6
Match NameE-valueIdentityDescription
AT1G11190.11.154e-10569.26| Symbols: BFN1, ENDO1 | bifunctional nuclease i |... [more]
AT4G21585.18.348e-7247.97| Symbols: ENDO4 | endonuclease 4 | chr4:11477988-... [more]
AT1G68290.11.925e-6848.36| Symbols: ENDO 2 | endonuclease 2 | chr1:25596718... [more]
AT4G21590.24.437e-6546.47| Symbols: ENDO3 | endonuclease 3 | chr4:11480524-... [more]
AT4G21590.14.437e-6546.47| Symbols: ENDO3 | endonuclease 3 | chr4:11480524-... [more]
AT4G21600.19.251e-6343.72| Symbols: ENDO5 | endonuclease 5 | chr4:11485319-... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003154S1/P1 nucleasePFAMPF02265S1-P1_nucleasecoord: 20..252
score: 2.2
IPR008947Phospholipase C/P1 nuclease, coreGENE3D1.10.575.10no descriptioncoord: 20..252
score: 2.6
IPR008947Phospholipase C/P1 nuclease, coreSUPERFAMILY48537Phospholipase C/P1 nucleasecoord: 20..253
score: 6.7
NoneNo IPR availableSEGsegsegcoord: 50..62
score

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO063314 ID=HO063314|Name=HO063314|organism=Cicer arietinum|type=EST|length=758bp
CGGCCGCGGGAATTCGATATCGAGCGGCCGCCCGGGCAGGTACCTGGTGT
CATTGCTTGGAGCAAAGAGGGTCATGAGATGACATGTCAAATTGCACAGG
CACTTTTAAAGCCTGAGGCATCAGAAGCAGTTCAGCAGTTGCTACCTCCC
TATGTGAATGGTAACTTATCAGCTCTATGTGTATGGCCTGATCAAATTAG
GCACTGGTACAAATATAGATGGACAAGTCCACTTCATTTCATTGACACAC
CAGATGATAAATGTGGTTTTCAATATTCAAGGGACTGCCATGAGGATATG
TGTGTTGCAGGAGCTATTAAAAATTTTACTTCTCAACTTTCTCATTACAA
AGAAGGAACATCTGATCGTAGATATAATATGACTGAGGCATTATTGTTCT
TGGCGCACTTCACAGGTGATATTCACCAGCCAATGCACGTTGGATTCACC
TCAGATAAAGGTGGAAACTCAATAGATCTACGCTGGTATAGGCACAAATC
TAATCTGCATCATGTGTGGGACAGAGAAATTATTCTCACATCATTATCAG
ATTACTATGACAAAGATGTGACACTCCTTCTCCAAGACATTGAGAAGAAC
TATACCAATGGAATCTGGTCAGATGATGTGGCTTCTTGGGAAAATTGCAA
TGGTATATCTCGTTGTGTAAACAATTGGGCAAAAGAGAGCATACAAATAG
CTTGCAGATGGGGTTATCAAGGAGTTGAATCTGGAATGACATTGGCAGAA
GAGTACCT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0004519endonuclease activity
Vocabulary: Biological Process
TermDefinition
GO:0006308DNA catabolic process
Vocabulary: INTERPRO
TermDefinition
IPR003154S1/P1nuclease
IPR008947PLipase_C/P1_nuclease_dom_sf