GR399445
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR399445 vs. TrEMBL
Match: C6THR5_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 1.451e-11 Identity = 38/86 (44.19%), Postives = 53/86 (61.63%), Query Frame = 3 Query: 144 WVPPQPPPIAMADSAQAIRRAKQAVS*EQVSKNPSSAQSSDISGEVNGIPKPAESECVEKSNGSSIICSSEIQILQEDHEAKYEEQ 401 WVPPQPPPIAM ++A+AIRR KQ V E + S+A SSD++ NG + +E + +S++ S EIQ +HE YEE+ Sbjct: 428 WVPPQPPPIAMPEAAEAIRRPKQVVQEEVTLDDQSAAHSSDLT---NG---SKSEDAIEGNVVNSLVSSGEIQ----NHEVGYEEK 503 HSP 2 Score: 28.4906 bits (62), Expect = 1.451e-11 Identity = 17/40 (42.50%), Postives = 23/40 (57.50%), Query Frame = 2 Query: 20 NEDDPLPYWLKRNVRILHIAQN-DSGGAPYGTASSRLPLQ 136 N D+ +P+W +NVRI I + GAP ASS P+Q Sbjct: 388 NGDNTVPWWQTKNVRIKEIDNEIEYNGAP--AASSPQPVQ 425
BLAST of GR399445 vs. TrEMBL
Match: B9I3A0_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_421624 PE=4 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 9.568e-10 Identity = 34/74 (45.95%), Postives = 51/74 (68.92%), Query Frame = 3 Query: 144 WVPPQPPPIAMADSAQAIRRAKQAVS*EQVSKNPSSAQSSDISGEVNGIPKPAES-ECVEKSNGSSIICSSEIQ 362 WVPP+PPP+ MA++A+AIRR KQ++ EQ+ + S + +D + E+ I K +ES VE + G S++ SSEIQ Sbjct: 401 WVPPRPPPVVMAEAAEAIRRPKQSIQKEQLEDDRSVSHPTDTADELQRITKISESGGAVEINGGGSVLNSSEIQ 474
BLAST of GR399445 vs. TrEMBL
Match: B9IER8_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_252078 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.632e-9 Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = 3 Query: 144 WVPPQPPPIAMADSAQAIRRAKQAVS*EQVSKNPSSAQSSDISGEVNGIPKPAES-ECVEKSNGSSIICSSEIQILQE 374 WVPPQPPP+ M ++A+AIRR KQ++ EQ + S + D + E+ I K +ES VE + G S++ SSEIQ QE Sbjct: 402 WVPPQPPPVVMPEAAEAIRRPKQSIQKEQSEDDQSVSHPIDTADELQRITKISESGGAVEINGGGSVLNSSEIQEEQE 479
BLAST of GR399445 vs. TrEMBL
Match: B9RB25_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1510590 PE=4 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.382e-8 Identity = 37/85 (43.53%), Postives = 54/85 (63.53%), Query Frame = 3 Query: 144 WVPPQPPPIAMADSAQAIRRAKQAVS*EQVSKNPSSAQSSDISGEVNGIPKPAES-ECVEKSNGSSIICSSEIQILQEDHEAKYE 395 WVPPQPPP+AMA++A+AIRR K +V EQ + S + +D + E+ I K AES + ++G S + S+EI +E+ E YE Sbjct: 452 WVPPQPPPVAMAEAAEAIRRPKPSVQKEQSGEEQSKSLQTDATDELQKITKIAESGGGMGINDGGSELNSNEI---KEEQEINYE 533
BLAST of GR399445 vs. TrEMBL
Match: D7SHS0_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00007750001 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 2.144e-8 Identity = 35/78 (44.87%), Postives = 48/78 (61.54%), Query Frame = 3 Query: 144 WVPPQPPPIAMADSAQAIRRAKQAVS*EQVSKNPSSAQSSDISGEVNGIPKPAES-ECVEKSNGSSIICSSEIQILQE 374 WVPPQPPPIAM ++A AIR+ K ++ E + + S ++ SD E+ I K +ES VE SS + SSE+Q QE Sbjct: 446 WVPPQPPPIAMPEAAAAIRQPKSSIQRESLVNDQSVSRPSDEIDELQRITKISESGGVVEIKEESSGLNSSEMQQEQE 523 HSP 2 Score: 25.409 bits (54), Expect = 2.144e-8 Identity = 12/36 (33.33%), Postives = 17/36 (47.22%), Query Frame = 2 Query: 29 DPLPYWLKRNVRILHIAQNDSGGAPYGTASSRLPLQ 136 D +W ++N RI I D TAS+ P+Q Sbjct: 408 DSSTWWQQKNARITEIETEDEPRTASYTASNEQPIQ 443
BLAST of GR399445 vs. TrEMBL
Match: A5AW25_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_005839 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 2.144e-8 Identity = 35/78 (44.87%), Postives = 48/78 (61.54%), Query Frame = 3 Query: 144 WVPPQPPPIAMADSAQAIRRAKQAVS*EQVSKNPSSAQSSDISGEVNGIPKPAES-ECVEKSNGSSIICSSEIQILQE 374 WVPPQPPPIAM ++A AIR+ K ++ E + + S ++ SD E+ I K +ES VE SS + SSE+Q QE Sbjct: 446 WVPPQPPPIAMPEAAAAIRQPKSSIQRESLVNDQSVSRPSDEIDELQRITKISESGGVVEIKEESSGLNSSEMQQEQE 523 HSP 2 Score: 25.409 bits (54), Expect = 2.144e-8 Identity = 12/36 (33.33%), Postives = 17/36 (47.22%), Query Frame = 2 Query: 29 DPLPYWLKRNVRILHIAQNDSGGAPYGTASSRLPLQ 136 D +W ++N RI I D TAS+ P+Q Sbjct: 408 DSSTWWQQKNARITEIETEDEPRTASYTASNEQPIQ 443
BLAST of GR399445 vs. TAIR peptide
Match: AT5G62810.1 (| Symbols: PEX14, ATPEX14, PED2 | peroxin 14 | chr5:25220323-25223571 FORWARD LENGTH=507) HSP 1 Score: 52.7582 bits (125), Expect = 1.497e-7 Identity = 35/95 (36.84%), Postives = 48/95 (50.53%), Query Frame = 3 Query: 111 LHPVDFHYNSVWVPPQPPPIAMADSAQAIRRAKQAVS*EQVSKNPSSAQSSDISGEVNGIPKPAESECVEKSNGSSIICSSEIQILQEDHEAKYE 395 + P F WVPPQPPP+AMA++ +AIRR K +Q + +S S +S E+ I K +ES +GS I +EIQ E E Sbjct: 417 MEPAAFQRQRSWVPPQPPPVAMAEAVEAIRRPKPQAKIDQ--EAAASDGQSGVSDELQKITKFSES----GGDGSGGIKIAEIQEETEQQHISQE 505 The following BLAST results are available for this feature:
BLAST of GR399445 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 6
BLAST of GR399445 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR399445 ID=GR399445; Name=GR399445; organism=Cicer arietinum; type=EST; length=562bpback to top |