HO062396
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO062396 vs. TrEMBL
Match: D7LK11_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_903726 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.229e-7 Identity = 34/83 (40.96%), Postives = 45/83 (54.22%), Query Frame = -3 Query: 166 RYARRAFLNSYHFNLERENGSFKEKTKRSMKEVNEGAMRVVLGMRRGMHKRRLGIRAYRVTMALPSMFLVTMRCFMPWFNKKD 414 R RR L SY + E SFKEK ++SMK +NE A R V +R+G KRR IR R + S F+ ++ CF P +D Sbjct: 29 RDGRRVVLASYDL-MGSERFSFKEKLRKSMKGINESAERWVSEVRQGTTKRRFAIRVLRTKLGFYSCFIRSVGCFTPCVGHRD 110
BLAST of HO062396 vs. TrEMBL
Match: B9HH37_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_763813 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.507e-7 Identity = 32/69 (46.38%), Postives = 46/69 (66.67%), Query Frame = -3 Query: 208 RYARRAFLNSYHFNLERENGSFKEKTKRSMKEVNEGAMRVVLGMRRGMHKRRLGIRAYRVTMALPSMFL 414 R ARRAFL+SYHF+ ENG ++K +RS+KE+NE VV +R + KRR+ I+ R ++ LP + L Sbjct: 39 RNARRAFLSSYHFS--EENG-IRDKLRRSVKEINEVVRGVVSDIREEICKRRIRIKVCRFSLGLPCLIL 104
BLAST of HO062396 vs. TAIR peptide
Match: AT2G43390.1 (| Symbols: | unknown protein; Has 7 Blast hits to 7 proteins in 3 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 7; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:18020500-18020844 REVERSE LENGTH=114) HSP 1 Score: 55.0694 bits (131), Expect = 1.760e-8 Identity = 34/83 (40.96%), Postives = 44/83 (53.01%), Query Frame = -3 Query: 166 RYARRAFLNSYHFNLERENGSFKEKTKRSMKEVNEGAMRVVLGMRRGMHKRRLGIRAYRVTMALPSMFLVTMRCFMPWFNKKD 414 R RR L SY + E SFKEK ++SMK +NE A R V +R+G KRR IR R + S F+ ++ CF KD Sbjct: 29 RDGRRIVLASYDL-MGSERFSFKEKLRKSMKGMNESAERWVSEVRQGTTKRRFAIRVLRTKLGFYSCFIRSVGCFTSCVGHKD 110 The following BLAST results are available for this feature:
BLAST of HO062396 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of HO062396 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO062396 ID=HO062396; Name=HO062396; organism=Cicer arietinum; type=EST; length=431bpback to top |