FE671043
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE671043 vs. TrEMBL
Match: D7SWE6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_31.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00022332001 PE=4 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 1.688e-12 Identity = 35/46 (76.09%), Postives = 42/46 (91.30%), Query Frame = -1 Query: 435 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPRK 572 LQ+LLKKGER+P+LPPIANFSYLTKSYSNVFAG ++N L+SPR+ Sbjct: 496 LQELLKKGERVPALPPIANFSYLTKSYSNVFAGCANTTNCLASPRQ 541
BLAST of FE671043 vs. TrEMBL
Match: B9H4L0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_860878 PE=4 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 2.879e-12 Identity = 35/45 (77.78%), Postives = 40/45 (88.89%), Query Frame = -1 Query: 438 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPR 572 LQ+LLKKGER+P+LPPI+NFSYLTKSYSNVF GF +S LSSPR Sbjct: 523 LQELLKKGERVPALPPISNFSYLTKSYSNVFTGFSAASACLSSPR 567
BLAST of FE671043 vs. TrEMBL
Match: A5C6Z1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_024978 PE=4 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 4.911e-12 Identity = 35/45 (77.78%), Postives = 40/45 (88.89%), Query Frame = -1 Query: 438 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPR 572 LQ LLKKGER+P+LPPIANFSYLTKSYSNVFAG ++N L+SPR Sbjct: 576 LQXLLKKGERVPALPPIANFSYLTKSYSNVFAGCANTTNCLASPR 620
BLAST of FE671043 vs. TrEMBL
Match: B9HEZ2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_562506 PE=4 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 6.413e-12 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = -1 Query: 438 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPR 572 LQ+LLKKGER+P+LPP NFSYLTKSYSNVFAGF T+S L SPR Sbjct: 570 LQELLKKGERVPALPPSDNFSYLTKSYSNVFAGFSTASTCLPSPR 614
BLAST of FE671043 vs. TrEMBL
Match: B9HEZ1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_868074 PE=4 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 6.413e-12 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = -1 Query: 438 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPR 572 LQ+LLKKGER+P+LPP NFSYLTKSYSNVFAGF T+S L SPR Sbjct: 553 LQELLKKGERVPALPPSDNFSYLTKSYSNVFAGFSTASTCLPSPR 597
BLAST of FE671043 vs. TrEMBL
Match: B9RRG0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1190410 PE=4 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 1.094e-11 Identity = 35/44 (79.55%), Postives = 38/44 (86.36%), Query Frame = -1 Query: 441 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSP 572 LQ+LLKKGER+P+LPPIANFSYLTKSYSNVFA F S LSSP Sbjct: 573 LQELLKKGERVPALPPIANFSYLTKSYSNVFASFSNVSTCLSSP 616
BLAST of FE671043 vs. TrEMBL
Match: B9FYN6_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_25747 PE=4 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 1.024e-9 Identity = 30/49 (61.22%), Postives = 40/49 (81.63%), Query Frame = -1 Query: 426 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPRKGRH 572 L+D++++GER+PSLPPI NF+YLTKSYSNVFA P S++ +SPR H Sbjct: 513 LEDMIRRGERVPSLPPIPNFAYLTKSYSNVFAVAPGSTSFPASPRYAYH 561
BLAST of FE671043 vs. TrEMBL
Match: Q6ZJM8_ORYSJ (F-box protein family-like OS=Oryza sativa subsp. japonica GN=OJ1300_E01.9 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.979e-9 Identity = 29/45 (64.44%), Postives = 39/45 (86.67%), Query Frame = -1 Query: 438 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPR 572 L+D++++GER+PSLPPI NF+YLTKSYSNVFA P S++ +SPR Sbjct: 513 LEDMIRRGERVPSLPPIPNFAYLTKSYSNVFAVAPGSTSFPASPR 557
BLAST of FE671043 vs. TrEMBL
Match: C5YLF8_SORBI (Putative uncharacterized protein Sb07g000565 (Fragment) OS=Sorghum bicolor GN=Sb07g000565 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.979e-9 Identity = 31/45 (68.89%), Postives = 38/45 (84.44%), Query Frame = -1 Query: 438 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSPR 572 L++LLKKGER+P+L P+ NF+YLTKSYSNVF GFP SS +SPR Sbjct: 433 LEELLKKGERVPALQPVPNFAYLTKSYSNVFTGFPGSS---ASPR 474
BLAST of FE671043 vs. TrEMBL
Match: B8BA68_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_27511 PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 1.132e-8 Identity = 28/44 (63.64%), Postives = 38/44 (86.36%), Query Frame = -1 Query: 441 LQDLLKKGERIPSLPPIANFSYLTKSYSNVFAGFPTSSNSLSSP 572 L+D++++GER+PSLPPI NF+YLTKSYSNVFA P S++ +SP Sbjct: 479 LEDMIRRGERVPSLPPIPNFAYLTKSYSNVFAVAPGSTSFPASP 522 The following BLAST results are available for this feature:
BLAST of FE671043 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE671043 ID=FE671043; Name=FE671043; organism=Cicer arietinum; type=EST; length=572bpback to top |