GR404302
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR404302 vs. TrEMBL
Match: B9SQT4_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1217400 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.021e-9 Identity = 36/82 (43.90%), Postives = 50/82 (60.98%), Query Frame = 1 Query: 1 RASSIQRPRAVVSSPENDILIGNRNKIGNGRQSALKNRTVLPNRHSQAQCKVKSHDTTDIPPDSRKCAEPKSKDKIDPVGKK 246 RAS + RPRAV+SSP+ND LI N+N++ + SALKN ++ +RH AQCKV D P + ++ + KID G K Sbjct: 109 RASLVPRPRAVISSPDNDALIANKNRVKATQPSALKNHNLIRSRH--AQCKVVPSQAIDESPLNTSKSKDTTDKKIDVRGTK 188
BLAST of GR404302 vs. TrEMBL
Match: D7U365_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_5.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00028417001 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.187e-7 Identity = 31/76 (40.79%), Postives = 47/76 (61.84%), Query Frame = 1 Query: 1 RASSIQRPRAVVSSPENDILIGNRNKIGNGRQSALKNRTVLPNRHSQAQCKVKSHDTTDIPPDSRKCAEPKSKDKI 228 RA S+ RPRAV+SSP+ND +IGN+NK+ + R S K +++ NRH Q + ++ H PP RK P + ++ Sbjct: 131 RACSVPRPRAVLSSPDNDGMIGNQNKLISNR-SIPKEQSLKQNRHVQIK-EIPIHGKAGSPPSMRKREAPNTNSRL 204 The following BLAST results are available for this feature:
BLAST of GR404302 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR404302 ID=GR404302; Name=GR404302; organism=Cicer arietinum; type=EST; length=339bpback to top |