GR408373
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR408373 vs. TrEMBL
Match: C6T4Z3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.008e-8 Identity = 28/42 (66.67%), Postives = 33/42 (78.57%), Query Frame = -2 Query: 281 VIRGANFPCLCTYKFILPSLGISVKDAMELPGKCGLKSPSKC 406 VIR AN CLC+YK ILPS GI+ K+A+ LPGKCGL+SP C Sbjct: 60 VIRQANLRCLCSYKSILPSFGINPKNALALPGKCGLQSPPNC 101
BLAST of GR408373 vs. TrEMBL
Match: C6T3C8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.933e-8 Identity = 27/42 (64.29%), Postives = 31/42 (73.81%), Query Frame = -2 Query: 281 VIRGANFPCLCTYKFILPSLGISVKDAMELPGKCGLKSPSKC 406 VIR AN PCLC YK ILP +GI + A+ LPGKCGL+SP C Sbjct: 60 VIRQANLPCLCRYKSILPLIGIKPEKALALPGKCGLQSPPNC 101
BLAST of GR408373 vs. TrEMBL
Match: C6SW78_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.483e-7 Identity = 26/42 (61.90%), Postives = 31/42 (73.81%), Query Frame = -2 Query: 281 VIRGANFPCLCTYKFILPSLGISVKDAMELPGKCGLKSPSKC 406 VIR AN CLC+YK ILPS GI+ K+A+ LP KCGL+ P C Sbjct: 62 VIRQANLRCLCSYKSILPSFGINPKNALALPAKCGLQLPPNC 103
BLAST of GR408373 vs. TrEMBL
Match: C6T2Y1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.243e-7 Identity = 25/42 (59.52%), Postives = 31/42 (73.81%), Query Frame = -2 Query: 281 VIRGANFPCLCTYKFILPSLGISVKDAMELPGKCGLKSPSKC 406 V+R AN CLC+YK LPS GI+ K+A+ LPGKCGL+ P C Sbjct: 60 VVRQANLRCLCSYKSTLPSFGINPKNALALPGKCGLQWPPNC 101 The following BLAST results are available for this feature:
BLAST of GR408373 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR408373 ID=GR408373; Name=GR408373; organism=Cicer arietinum; type=EST; length=407bpback to top |