FE670944
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE670944 vs. TrEMBL
Match: A0A8Y2_IPOTF (Putative uncharacterized protein OS=Ipomoea trifida PE=4 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 2.737e-14 Identity = 33/55 (60.00%), Postives = 41/55 (74.55%), Query Frame = 3 Query: 360 MPTHRTWMYNRLLPGRKGYTVEFLQGVEEFIDFACQQPNYLNEGVIKCPCKLCKN 524 +P HR WMYNRL PG++GYT EFL GVEEF+++AC P Y + I+CPC CKN Sbjct: 61 IPEHRKWMYNRLSPGKRGYTDEFLAGVEEFVNYACTLPVYESTNTIRCPCSKCKN 115
BLAST of FE670944 vs. TrEMBL
Match: Q6JJ63_IPOTF (Putative tnp2 transposase OS=Ipomoea trifida PE=4 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 8.241e-11 Identity = 29/48 (60.42%), Postives = 36/48 (75.00%), Query Frame = 3 Query: 381 MYNRLLPGRKGYTVEFLQGVEEFIDFACQQPNYLNEGVIKCPCKLCKN 524 MYNRL PG++GYT EFL GVEEF+++AC P Y + I+CPC CKN Sbjct: 1 MYNRLSPGKRGYTDEFLAGVEEFVNYACTLPVYESTNTIRCPCSKCKN 48
BLAST of FE670944 vs. TrEMBL
Match: Q1S5L7_MEDTR (Putative uncharacterized protein OS=Medicago truncatula GN=MtrDRAFT_AC147431g29v2 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 7.219e-7 Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = 3 Query: 369 HRTWMYNRLLPGRKGYTVEFLQGVEEFIDFACQQPNYLNEGVIKCPCKLC 518 +R+WMY+R PGR+G F++GV FI +A +Q NEG I+CPC C Sbjct: 7 YRSWMYDRTFPGRRGLKPHFVEGVHGFISWAWEQQVRQNEGGIRCPCLKC 56 The following BLAST results are available for this feature:
BLAST of FE670944 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE670944 ID=FE670944; Name=FE670944; organism=Cicer arietinum; type=EST; length=548bpback to top |