FE671796
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE671796 vs. TrEMBL
Match: C6TMA8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 8.625e-9 Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = 2 Query: 380 STSELMASAKIVAEAAQSGLGKETDK---AKVADAAGDLLEAVGQYAKLD 520 ST+EL+ SAK+VAEAAQS L ++DK AKVADAAGDLL+A G+Y KLD Sbjct: 15 STTELITSAKLVAEAAQSALKSDSDKVDKAKVADAAGDLLDAAGKYGKLD 64
BLAST of FE671796 vs. TrEMBL
Match: A9P8J5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_724071 PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 8.073e-7 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 2 Query: 368 EKKYSTSELMASAKIVAEAAQSGLGKETDK---AKVADAAGDLLEAVGQYAKLD 520 +++ +TSEL++SAK+VA AAQS G E DK AKVA AA DLLEA +Y KLD Sbjct: 13 DRQPTTSELLSSAKLVAGAAQSSFGSEGDKIDRAKVAGAAEDLLEAASKYGKLD 66
BLAST of FE671796 vs. TAIR peptide
Match: AT2G03440.1 (| Symbols: NRP1, ATNRP1 | nodulin-related protein 1 | chr2:1039409-1039972 REVERSE LENGTH=187) HSP 1 Score: 52.373 bits (124), Expect = 1.706e-7 Identity = 29/50 (58.00%), Postives = 36/50 (72.00%), Query Frame = 2 Query: 380 STSELMASAKIVAEAAQSGLGKET---DKAKVADAAGDLLEAVGQYAKLD 520 + +ELMASAKIVAEAAQ+ E+ DKAKVA A D+L+A +Y KLD Sbjct: 64 TNAELMASAKIVAEAAQAAARHESDKLDKAKVAGATADILDAASRYGKLD 113 The following BLAST results are available for this feature:
BLAST of FE671796 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of FE671796 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE671796 ID=FE671796; Name=FE671796; organism=Cicer arietinum; type=EST; length=522bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|