GR917858
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR917858 vs. SwissProt
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2) HSP 1 Score: 59.6918 bits (143), Expect = 5.426e-9 Identity = 25/34 (73.53%), Postives = 31/34 (91.18%), Query Frame = -3 Query: 42 DMIDMAERDGFVLTKLIPLKAMCKTRPVVNRLIK 143 D ID+AERDGF LTKL+PLKAMCK+RPV+N++ K Sbjct: 465 DKIDLAERDGFTLTKLVPLKAMCKSRPVINKVFK 498
BLAST of GR917858 vs. TrEMBL
Match: Q8L6V5_CICAR (Putative cytochrome P450 monooxygenase (Fragment) OS=Cicer arietinum PE=2 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.471e-12 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = -3 Query: 42 TSDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNRLIK 152 TSDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNR+IK Sbjct: 27 TSDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNRIIK 63
BLAST of GR917858 vs. TrEMBL
Match: Q9XFX0_CICAR (Cytochrome P450 monooxygenase OS=Cicer arietinum GN=cyp81E3v2 PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.246e-11 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = -3 Query: 42 TSDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNRLIK 152 TSDDMIDMAERDGFVLTKL+PLKAMCKTRPVVN++ K Sbjct: 462 TSDDMIDMAERDGFVLTKLVPLKAMCKTRPVVNKIFK 498
BLAST of GR917858 vs. TrEMBL
Match: Q9ZRW6_CICAR (Cytochrome P450 OS=Cicer arietinum GN=cyp81E3 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 6.182e-11 Identity = 33/37 (89.19%), Postives = 35/37 (94.59%), Query Frame = -3 Query: 42 TSDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNRLIK 152 TSDD IDMAERDGFVLTKLIPLKAMCKTRPVVN++ K Sbjct: 462 TSDDKIDMAERDGFVLTKLIPLKAMCKTRPVVNKVFK 498
BLAST of GR917858 vs. TrEMBL
Match: Q9ZWF2_GLYEC (Cytochrome P450 OS=Glycyrrhiza echinata GN=CYP Ge-31 PE=2 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.289e-8 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = -3 Query: 42 TSDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNRLIK 152 T+ D IDMAERDGF LTKL+PLKAMCK+RPV+N++ K Sbjct: 462 TNGDKIDMAERDGFTLTKLVPLKAMCKSRPVINKVFK 498
BLAST of GR917858 vs. TrEMBL
Match: Q6WNR0_MEDTR (Isoflavone 2'-hydroxylase OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.872e-8 Identity = 26/36 (72.22%), Postives = 33/36 (91.67%), Query Frame = -3 Query: 42 SDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNRLIK 149 +D+ IDM+ERDGF +TKL+PLKAMCKTRPVVN++ K Sbjct: 463 NDEKIDMSERDGFTMTKLLPLKAMCKTRPVVNKVFK 498
BLAST of GR917858 vs. TrEMBL
Match: Q9MBE4_LOTJA (Cytochrome P450 OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.238e-7 Identity = 25/36 (69.44%), Postives = 30/36 (83.33%), Query Frame = -3 Query: 42 SDDMIDMAERDGFVLTKLIPLKAMCKTRPVVNRLIK 149 SD+ IDM ERDGFVL K IP+KAMCK+RPV+N + K Sbjct: 464 SDEEIDMGERDGFVLMKSIPVKAMCKSRPVINNVFK 499 The following BLAST results are available for this feature:
BLAST of GR917858 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of GR917858 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 6
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR917858 ID=GR917858; Name=GR917858; organism=Cicer arietinum; type=EST; length=244bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|