HO664291
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO664291 vs. TrEMBL
Match: B9RRG5_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1190860 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.455e-9 Identity = 35/64 (54.69%), Postives = 43/64 (67.19%), Query Frame = 3 Query: 21 SVGPKKRKG--EEIKSPSKKRAKPDKEASEDNSDAEDGGKNSEDDQSHSSAENTTQKKQVSTPV 206 S G KKRK +E K SKKR KP ++ +ED+SDAED G SED +S SSAE +KK+ TPV Sbjct: 277 SEGSKKRKRFEKETKVTSKKRVKPTEKVAEDSSDAEDSGNASEDGRSQSSAEKPVKKKEAPTPV 340
BLAST of HO664291 vs. TrEMBL
Match: B9GU54_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_816287 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.516e-7 Identity = 33/67 (49.25%), Postives = 43/67 (64.18%), Query Frame = 3 Query: 9 KGKASVGPKKRKG--EEIKSPSKKRAKPDKEASEDNSDAEDGGKNSEDDQSHSSAENTTQKKQVSTP 203 K + S G KKR+ +E K + KR KP + A+EDNSD+E G SED+ S SSAE +KK+ STP Sbjct: 251 KMQNSEGSKKRRRTEKETKVSANKRIKPLETAAEDNSDSEVSGNASEDNNSPSSAEKPVKKKEASTP 317 The following BLAST results are available for this feature:
BLAST of HO664291 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO664291 ID=HO664291; Name=HO664291; organism=Cicer arietinum; type=EST; length=229bpback to top |