FE672592
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672592 vs. TAIR peptide
Match: AT1G80610.1 (| Symbols: | unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G15800.1); Has 73 Blast hits to 69 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi - 2; Plants - 55; Viruses - 0; Other Eukaryotes - 14 (source: NCBI BLink). | chr1:30301204-30303960 REVERSE LENGTH=211) HSP 1 Score: 51.9878 bits (123), Expect = 1.297e-7 Identity = 30/73 (41.10%), Postives = 39/73 (53.42%), Query Frame = 1 Query: 199 DWVNFAMADDSIVADXXXXXXXXXXXXXXXXH-----WTVRQRRSRSLPKHAAKPESTRISPTTPLSWNGATS 402 +W+ AM+DDS+VA+ W+VRQRRS+ K + TR SPTTPLSW+GATS Sbjct: 5 NWIRVAMSDDSMVAEALLRLRHSEPKNRVDASPLKLKWSVRQRRSK-------KGDQTRASPTTPLSWSGATS 70
BLAST of FE672592 vs. TAIR peptide
Match: AT1G15800.1 (| Symbols: | unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G80610.1); Has 56 Blast hits to 52 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 56; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:5441425-5443584 REVERSE LENGTH=207) HSP 1 Score: 50.0618 bits (118), Expect = 4.929e-7 Identity = 28/77 (36.36%), Postives = 37/77 (48.05%), Query Frame = 1 Query: 199 DWVNFAMADDSIVADXXXXXXXXXXXXXXXXH---------WTVRQRRSRSLPKHAAKPESTRISPTTPLSWNGATS 402 DW++ AM DDS+VA+ W+VRQ R+++ TR SPTTPLSW+GATS Sbjct: 5 DWIHEAMGDDSLVAEALICLLHAEPSLPETKSGGASDLKLKWSVRQPRTKAATLRKKGDHDTRASPTTPLSWSGATS 81 The following BLAST results are available for this feature:
BLAST of FE672592 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672592 ID=FE672592; Name=FE672592; organism=Cicer arietinum; type=EST; length=405bpback to top |