FL518992
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FL518992 vs. SwissProt
Match: NACA2_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana GN=At3g49470 PE=2 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 1.297e-10 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSRSKAVKALK+H+GDIV AIMELTT Sbjct: 181 RDIDLVMTQAGVSRSKAVKALKSHDGDIVSAIMELTT 217
BLAST of FL518992 vs. SwissProt
Match: NACA4_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana GN=At4g10480 PE=2 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.447e-9 Identity = 32/37 (86.49%), Postives = 33/37 (89.19%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSR KAVKALK NGDIV AIMELTT Sbjct: 176 KDIDLVMTQAGVSRPKAVKALKESNGDIVSAIMELTT 212
BLAST of FL518992 vs. SwissProt
Match: NACA5_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana GN=At1g33040 PE=2 SV=2) HSP 1 Score: 58.9214 bits (141), Expect = 8.333e-9 Identity = 29/37 (78.38%), Postives = 34/37 (91.89%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVS++KAV ALK ++GDIV AIMELTT Sbjct: 173 RDIDLVMTQAGVSKAKAVSALKANDGDIVSAIMELTT 209 HSP 2 Score: 21.1718 bits (43), Expect = 8.333e-9 Identity = 10/32 (31.25%), Postives = 16/32 (50.00%), Query Frame = -2 Query: 463 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAAI 558 S+ Q +FKMPD+ + GS+ A + Sbjct: 125 SQLQTQAAQRFKMPDVTSMLPNAGSEATMAPL 156
BLAST of FL518992 vs. SwissProt
Match: NACA1_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana GN=At3g12390 PE=1 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.820e-8 Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DI+LVMTQAGVSR AVKALK +GDIV AIMELTT Sbjct: 167 KDIELVMTQAGVSRPNAVKALKAADGDIVSAIMELTT 203 HSP 2 Score: 22.3274 bits (46), Expect = 1.820e-8 Identity = 12/33 (36.36%), Postives = 17/33 (51.52%), Query Frame = -2 Query: 460 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAAIQ 558 S+ +Q +FK PD+ V K G AA +Q Sbjct: 123 SQIQSQAAEQFKAPDLSNVISK-GESSSAAVVQ 154
BLAST of FL518992 vs. SwissProt
Match: NACA_PINTA (Nascent polypeptide-associated complex subunit alpha-like protein OS=Pinus taeda PE=2 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.533e-8 Identity = 29/37 (78.38%), Postives = 34/37 (91.89%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DI+LVMTQAGVSR+KAVKALK +GDIV AIM+LTT Sbjct: 169 KDIELVMTQAGVSRTKAVKALKAADGDIVSAIMDLTT 205
BLAST of FL518992 vs. SwissProt
Match: NACA3_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana GN=At5g13850 PE=1 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.614e-8 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DI+LVMTQAGVS+ +AVKALK NGDIV AIMELTT Sbjct: 168 KDIELVMTQAGVSKPRAVKALKLANGDIVSAIMELTT 204
BLAST of FL518992 vs. TrEMBL
Match: C6TI89_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.485e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = -3 Query: 303 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 410 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT Sbjct: 188 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 223 HSP 2 Score: 28.4906 bits (62), Expect = 1.485e-13 Identity = 13/31 (41.94%), Postives = 16/31 (51.61%), Query Frame = -2 Query: 466 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAA 558 S+ Q +F+MPDMG V K AAA Sbjct: 141 SQLQTQAAQQFRMPDMGSVTAKQEDAAAAAA 171
BLAST of FL518992 vs. TrEMBL
Match: C6SY77_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.486e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = -3 Query: 303 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 410 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT Sbjct: 187 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 222 HSP 2 Score: 28.4906 bits (62), Expect = 1.486e-13 Identity = 13/31 (41.94%), Postives = 16/31 (51.61%), Query Frame = -2 Query: 466 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAA 558 S+ Q +F+MPDMG V K AAA Sbjct: 140 SQLQTQAAQQFRMPDMGSVTAKQEDAAAAAA 170
BLAST of FL518992 vs. TrEMBL
Match: C6SYH0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 7.143e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = -3 Query: 303 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 410 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT Sbjct: 190 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 225 HSP 2 Score: 26.1794 bits (56), Expect = 7.143e-13 Identity = 13/33 (39.39%), Postives = 16/33 (48.48%), Query Frame = -2 Query: 460 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAAIQ 558 S+ Q +F MPD+G V K AAA Q Sbjct: 141 SQLQTQAAQQFGMPDVGSVLAKQDQDAAAAAAQ 173
BLAST of FL518992 vs. TrEMBL
Match: B7FMW4_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.431e-12 Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = -3 Query: 303 DIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 410 DIDLVMTQAGVS+SKAVKALKTHNGDIVGAIMELTT Sbjct: 192 DIDLVMTQAGVSKSKAVKALKTHNGDIVGAIMELTT 227 HSP 2 Score: 25.0238 bits (53), Expect = 3.431e-12 Identity = 11/30 (36.67%), Postives = 15/30 (50.00%), Query Frame = -2 Query: 469 SEANNQLPSKFKMPDMGFVNGKDGSKVGAA 558 S+ Q +F+MPDMG V K A+ Sbjct: 143 SQLQTQAAQQFRMPDMGSVMAKQDQGASAS 172
BLAST of FL518992 vs. TrEMBL
Match: B9S5M4_RICCO (Nascent polypeptide associated complex alpha subunit, putative OS=Ricinus communis GN=RCOM_0755870 PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.025e-10 Identity = 33/37 (89.19%), Postives = 35/37 (94.59%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGV RSKAVKALKTH+GDIV AIMELTT Sbjct: 192 RDIDLVMTQAGVPRSKAVKALKTHSGDIVSAIMELTT 228 HSP 2 Score: 24.6386 bits (52), Expect = 1.025e-10 Identity = 13/33 (39.39%), Postives = 16/33 (48.48%), Query Frame = -2 Query: 460 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAAIQ 558 S+ Q +F+MPDM V K AAA Q Sbjct: 144 SQLQTQAAQQFRMPDMASVLPKSDLSGAAAAAQ 176
BLAST of FL518992 vs. TrEMBL
Match: B9I289_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_806309 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 6.842e-10 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSRSKAVKAL+T+NGDIV AIMELTT Sbjct: 97 RDIDLVMTQAGVSRSKAVKALQTNNGDIVSAIMELTT 133 HSP 2 Score: 22.3274 bits (46), Expect = 6.842e-10 Identity = 10/31 (32.26%), Postives = 16/31 (51.61%), Query Frame = -2 Query: 466 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAA 558 S+ Q +F++PDM + K + AAA Sbjct: 49 SQLQTQAAQQFRVPDMSSMLPKPDASTAAAA 79
BLAST of FL518992 vs. TrEMBL
Match: B9IDG2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_574643 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 8.278e-10 Identity = 32/37 (86.49%), Postives = 36/37 (97.30%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSR+KAVKAL+T+NGDIV AIMELTT Sbjct: 189 RDIDLVMTQAGVSRTKAVKALQTNNGDIVSAIMELTT 225 HSP 2 Score: 23.0978 bits (48), Expect = 8.278e-10 Identity = 10/31 (32.26%), Postives = 16/31 (51.61%), Query Frame = -2 Query: 466 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAA 558 S+ Q +F+MPDM + K + AA+ Sbjct: 141 SQLQTQAAQQFRMPDMSSMLPKSDASTAAAS 171
BLAST of FL518992 vs. TrEMBL
Match: A9PB21_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 8.280e-10 Identity = 32/37 (86.49%), Postives = 36/37 (97.30%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSR+KAVKAL+T+NGDIV AIMELTT Sbjct: 188 RDIDLVMTQAGVSRTKAVKALQTNNGDIVSAIMELTT 224 HSP 2 Score: 23.0978 bits (48), Expect = 8.280e-10 Identity = 10/31 (32.26%), Postives = 16/31 (51.61%), Query Frame = -2 Query: 466 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAA 558 S+ Q +F+MPDM + K + AA+ Sbjct: 140 SQLQTQAAQQFRMPDMSSMLPKSDASTAAAS 170
BLAST of FL518992 vs. TrEMBL
Match: B9NIR5_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_791624 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 9.149e-10 Identity = 32/37 (86.49%), Postives = 36/37 (97.30%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSR+KAVKAL+T+NGDIV AIMELTT Sbjct: 80 RDIDLVMTQAGVSRTKAVKALQTNNGDIVSAIMELTT 116 HSP 2 Score: 23.0978 bits (48), Expect = 9.149e-10 Identity = 10/31 (32.26%), Postives = 16/31 (51.61%), Query Frame = -2 Query: 466 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAA 558 S+ Q +F+MPDM + K + AA+ Sbjct: 32 SQLQTQAAQQFRMPDMSSMLPKSDASTAAAS 62
BLAST of FL518992 vs. TrEMBL
Match: D7LYP3_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_489891 PE=4 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.970e-9 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSR+KAVKALK +GDIV AIMELTT Sbjct: 176 KDIDLVMTQAGVSRTKAVKALKASDGDIVSAIMELTT 212 HSP 2 Score: 23.8682 bits (50), Expect = 3.970e-9 Identity = 12/32 (37.50%), Postives = 16/32 (50.00%), Query Frame = -2 Query: 466 SEANNQLPSKFKMPDM-GFVNGKDGSKVGAAA 558 S+ Q KFKMPD+ + DGS+ A Sbjct: 128 SQLQAQAAQKFKMPDVASMIPNTDGSEAATVA 159
BLAST of FL518992 vs. TAIR peptide
Match: AT3G49470.1 (| Symbols: NACA2 | nascent polypeptide-associated complex subunit alpha-like protein 2 | chr3:18341072-18342273 FORWARD LENGTH=217) HSP 1 Score: 66.2402 bits (160), Expect = 1.375e-11 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSRSKAVKALK+H+GDIV AIMELTT Sbjct: 181 RDIDLVMTQAGVSRSKAVKALKSHDGDIVSAIMELTT 217
BLAST of FL518992 vs. TAIR peptide
Match: AT4G10480.2 (| Symbols: | Nascent polypeptide-associated complex (NAC), alpha subunit family protein | chr4:6478089-6479079 REVERSE LENGTH=211) HSP 1 Score: 62.003 bits (149), Expect = 2.594e-10 Identity = 32/37 (86.49%), Postives = 33/37 (89.19%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSR KAVKALK NGDIV AIMELTT Sbjct: 175 KDIDLVMTQAGVSRPKAVKALKESNGDIVSAIMELTT 211
BLAST of FL518992 vs. TAIR peptide
Match: AT4G10480.1 (| Symbols: | Nascent polypeptide-associated complex (NAC), alpha subunit family protein | chr4:6478089-6479079 REVERSE LENGTH=212) HSP 1 Score: 62.003 bits (149), Expect = 2.594e-10 Identity = 32/37 (86.49%), Postives = 33/37 (89.19%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVSR KAVKALK NGDIV AIMELTT Sbjct: 176 KDIDLVMTQAGVSRPKAVKALKESNGDIVSAIMELTT 212
BLAST of FL518992 vs. TAIR peptide
Match: AT1G33040.1 (| Symbols: NACA5 | nascent polypeptide-associated complex subunit alpha-like protein 5 | chr1:11966547-11967696 FORWARD LENGTH=209) HSP 1 Score: 58.9214 bits (141), Expect = 8.757e-10 Identity = 29/37 (78.38%), Postives = 34/37 (91.89%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DIDLVMTQAGVS++KAV ALK ++GDIV AIMELTT Sbjct: 173 RDIDLVMTQAGVSKAKAVSALKANDGDIVSAIMELTT 209 HSP 2 Score: 21.1718 bits (43), Expect = 8.757e-10 Identity = 10/32 (31.25%), Postives = 16/32 (50.00%), Query Frame = -2 Query: 463 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAAI 558 S+ Q +FKMPD+ + GS+ A + Sbjct: 125 SQLQTQAAQRFKMPDVTSMLPNAGSEATMAPL 156
BLAST of FL518992 vs. TAIR peptide
Match: AT3G12390.1 (| Symbols: | Nascent polypeptide-associated complex (NAC), alpha subunit family protein | chr3:3942344-3943595 FORWARD LENGTH=203) HSP 1 Score: 56.6102 bits (135), Expect = 1.912e-9 Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DI+LVMTQAGVSR AVKALK +GDIV AIMELTT Sbjct: 167 KDIELVMTQAGVSRPNAVKALKAADGDIVSAIMELTT 203 HSP 2 Score: 22.3274 bits (46), Expect = 1.912e-9 Identity = 12/33 (36.36%), Postives = 17/33 (51.52%), Query Frame = -2 Query: 460 SEANNQLPSKFKMPDMGFVNGKDGSKVGAAAIQ 558 S+ +Q +FK PD+ V K G AA +Q Sbjct: 123 SQIQSQAAEQFKAPDLSNVISK-GESSSAAVVQ 154
BLAST of FL518992 vs. TAIR peptide
Match: AT5G13850.1 (| Symbols: NACA3 | nascent polypeptide-associated complex subunit alpha-like protein 3 | chr5:4471361-4472676 FORWARD LENGTH=204) HSP 1 Score: 57.7658 bits (138), Expect = 4.892e-9 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = -3 Query: 303 QDIDLVMTQAGVSRSKAVKALKTHNGDIVGAIMELTT 413 +DI+LVMTQAGVS+ +AVKALK NGDIV AIMELTT Sbjct: 168 KDIELVMTQAGVSKPRAVKALKLANGDIVSAIMELTT 204 The following BLAST results are available for this feature:
BLAST of FL518992 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 6
BLAST of FL518992 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of FL518992 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 6
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FL518992 ID=FL518992; Name=FL518992; organism=Cicer arietinum; type=EST; length=580bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|