GR917732
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR917732 vs. TrEMBL
Match: C6T7E7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 94.7449 bits (234), Expect = 3.072e-18 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 3 Query: 24 YSIDFGKSEVEVIKHVSNYLDPADSEILLDLLASSELKVTYQPYDWGLN 170 YSIDFGK+EVEVIKHVSNYLD ADSE+LLDLLA+SELKVTY PYDWGLN Sbjct: 288 YSIDFGKNEVEVIKHVSNYLDSADSEVLLDLLATSELKVTYHPYDWGLN 336
BLAST of GR917732 vs. TrEMBL
Match: B9RJD7_RICCO (Electron transporter, putative OS=Ricinus communis GN=RCOM_1033310 PE=4 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 1.208e-14 Identity = 36/49 (73.47%), Postives = 44/49 (89.80%), Query Frame = 3 Query: 24 YSIDFGKSEVEVIKHVSNYLDPADSEILLDLLASSELKVTYQPYDWGLN 170 +S+DFGK+EVEV+KH SNYL+PA+SE LL+LLA +LKV YQPYDWGLN Sbjct: 682 FSMDFGKNEVEVLKHASNYLEPANSEALLELLAQGQLKVQYQPYDWGLN 730
BLAST of GR917732 vs. TrEMBL
Match: Q67UI1_ORYSJ (Glutaredoxin-related-like protein OS=Oryza sativa subsp. japonica GN=P0638H11.29 PE=2 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.076e-13 Identity = 33/49 (67.35%), Postives = 42/49 (85.71%), Query Frame = 3 Query: 24 YSIDFGKSEVEVIKHVSNYLDPADSEILLDLLASSELKVTYQPYDWGLN 170 YS DFGK+E EV+KH +NYL+PA+SE L+LLA+++LKV YQPYDW LN Sbjct: 662 YSTDFGKNETEVLKHAANYLEPAESEQFLELLANTQLKVLYQPYDWSLN 710
BLAST of GR917732 vs. TrEMBL
Match: B9FSA2_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_20649 PE=4 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.076e-13 Identity = 33/49 (67.35%), Postives = 42/49 (85.71%), Query Frame = 3 Query: 24 YSIDFGKSEVEVIKHVSNYLDPADSEILLDLLASSELKVTYQPYDWGLN 170 YS DFGK+E EV+KH +NYL+PA+SE L+LLA+++LKV YQPYDW LN Sbjct: 662 YSTDFGKNETEVLKHAANYLEPAESEQFLELLANTQLKVLYQPYDWSLN 710
BLAST of GR917732 vs. TrEMBL
Match: B8B477_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_22215 PE=4 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.076e-13 Identity = 33/49 (67.35%), Postives = 42/49 (85.71%), Query Frame = 3 Query: 24 YSIDFGKSEVEVIKHVSNYLDPADSEILLDLLASSELKVTYQPYDWGLN 170 YS DFGK+E EV+KH +NYL+PA+SE L+LLA+++LKV YQPYDW LN Sbjct: 662 YSTDFGKNETEVLKHAANYLEPAESEQFLELLANTQLKVLYQPYDWSLN 710
BLAST of GR917732 vs. TrEMBL
Match: C5Z711_SORBI (Putative uncharacterized protein Sb10g007910 OS=Sorghum bicolor GN=Sb10g007910 PE=4 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.297e-12 Identity = 33/49 (67.35%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 24 YSIDFGKSEVEVIKHVSNYLDPADSEILLDLLASSELKVTYQPYDWGLN 170 YS DFGK+E EV+KH +NYL PA+SE LL+LLAS++LKV YQ YDW +N Sbjct: 663 YSTDFGKNETEVLKHAANYLAPAESEQLLELLASTQLKVMYQNYDWSIN 711
BLAST of GR917732 vs. TAIR peptide
Match: AT4G08550.1 (| Symbols: | electron carriers;protein disulfide oxidoreductases | chr4:5444345-5446825 FORWARD LENGTH=637) HSP 1 Score: 64.6994 bits (156), Expect = 1.518e-11 Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 3 Query: 24 YSIDFGKSEVEVIKHVSNYLDPADSEILLDLLASSELKVTYQPYDWGLN 170 Y +DFG + E++KH S +L+P SE LLD L ++ +V YQPYDWGLN Sbjct: 588 YGVDFGNGKEEILKHASTFLEPQLSEALLDCLVDTQFEVKYQPYDWGLN 636 The following BLAST results are available for this feature:
BLAST of GR917732 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 6
BLAST of GR917732 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR917732 ID=GR917732; Name=GR917732; organism=Cicer arietinum; type=EST; length=375bpback to top |