HO066667
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO066667 vs. SwissProt
Match: MT1_CICAR (Metallothionein-like protein 1 OS=Cicer arietinum PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 9.231e-12 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = -1 Query: 327 TKIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 425 TKI FEGAEMSVAAEDGG KCGSSC CDPCNCK Sbjct: 43 TKIHFEGAEMSVAAEDGGCKCGSSCTCDPCNCK 75
BLAST of HO066667 vs. SwissProt
Match: MT1_PEA (Metallothionein-like protein 1 OS=Pisum sativum GN=MTA PE=3 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 3.878e-10 Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 KIQFEGAEMS A+EDGG KCG +C CDPCNCK Sbjct: 44 KIQFEGAEMSAASEDGGCKCGDNCTCDPCNCK 75
BLAST of HO066667 vs. SwissProt
Match: MT1_TRIRP (Metallothionein-like protein 1 OS=Trifolium repens GN=MT1B PE=3 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 8.640e-10 Identity = 27/32 (84.38%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 KIQFE AEM VAAED G KCGSSC CDPCNCK Sbjct: 44 KIQFEDAEMGVAAEDSGCKCGSSCTCDPCNCK 75
BLAST of HO066667 vs. SwissProt
Match: MT1B_VICFA (Metallothionein-like protein 1B OS=Vicia faba GN=MT1B PE=3 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 4.288e-9 Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 KIQFEGAEMS A+++GG KCG +C CDPCNCK Sbjct: 44 KIQFEGAEMSFASKEGGCKCGDNCTCDPCNCK 75
BLAST of HO066667 vs. SwissProt
Match: MT1A_VICFA (Metallothionein-like protein 1A OS=Vicia faba GN=MT1A PE=3 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 4.014e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = -1 Query: 330 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNC 422 KI F+GAEMSVA+++ G KCG C CDPCNC Sbjct: 47 KIHFDGAEMSVASKEEGCKCGDKCTCDPCNC 77
BLAST of HO066667 vs. TrEMBL
Match: Q75NH7_PEA (Type 1 metallothionein OS=Pisum sativum GN=MEY PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.126e-10 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 KIQF+GAEMSVAAEDGG KCG SC CDPCNCK Sbjct: 44 KIQFDGAEMSVAAEDGGCKCGDSCTCDPCNCK 75
BLAST of HO066667 vs. TrEMBL
Match: B7FMK6_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.655e-9 Identity = 34/62 (54.84%), Postives = 37/62 (59.68%), Query Frame = 2 Query: 260 YTQLHIXVPISLPQAFICY----MHLTCSCKGHMXSLIHTCGHHLQLQHSFQLPRTESSSDQ 433 YTQLHI VPI ++C+ MH CSCKGHM S HTC HH QL H FQ R S DQ Sbjct: 28 YTQLHILVPI-----YLCFKRHMMHFICSCKGHMCSYPHTCSHHPQLLHPFQHLRIGSWPDQ 84
BLAST of HO066667 vs. TrEMBL
Match: Q9SP23_MEDSA (Type 1 metallothionein OS=Medicago sativa GN=MET1 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.529e-9 Identity = 27/32 (84.38%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 KI FEGAEM VAAEDGG KCG SC CDPCNCK Sbjct: 44 KIHFEGAEMGVAAEDGGCKCGDSCTCDPCNCK 75
BLAST of HO066667 vs. TrEMBL
Match: A5JSU2_9FABA (Metallothionein type 2 OS=Sesbania drummondii GN=MT2 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.529e-9 Identity = 26/32 (81.25%), Postives = 29/32 (90.62%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 K+QFEGAEM VAAE+GG KCGS+C CDPCNCK Sbjct: 48 KVQFEGAEMGVAAENGGCKCGSNCPCDPCNCK 79
BLAST of HO066667 vs. TrEMBL
Match: Q75NI4_PHAAU (Type 1 metallothionein OS=Phaseolus aureus GN=MET PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.721e-8 Identity = 26/32 (81.25%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 K QFEGAEM VAAED G KCGS+C CDPCNCK Sbjct: 42 KAQFEGAEMGVAAEDNGCKCGSNCTCDPCNCK 73
BLAST of HO066667 vs. TrEMBL
Match: Q75NI0_PHAAN (Type 1 metallothionein OS=Phaseolus angularis GN=MET PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.721e-8 Identity = 26/32 (81.25%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 K QFEGAEM VAAED G KCGS+C CDPCNCK Sbjct: 42 KAQFEGAEMGVAAEDNGCKCGSNCPCDPCNCK 73
BLAST of HO066667 vs. TrEMBL
Match: Q75NH5_DOLLA (Type 1 metallothionein OS=Dolichos lab lab GN=MET PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.007e-8 Identity = 25/32 (78.12%), Postives = 26/32 (81.25%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 K QFEG EM VAAED G KCGS+C CDPCNCK Sbjct: 42 KAQFEGGEMGVAAEDSGCKCGSNCTCDPCNCK 73
BLAST of HO066667 vs. TrEMBL
Match: Q75NH8_VICFA (Type 1 metallothionein OS=Vicia faba GN=MET PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.541e-8 Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 KIQFEG EMSVA+++GG KCG +C CDPCNCK Sbjct: 44 KIQFEGDEMSVASKEGGCKCGDNCTCDPCNCK 75
BLAST of HO066667 vs. TrEMBL
Match: C6SZC9_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.116e-7 Identity = 25/32 (78.12%), Postives = 26/32 (81.25%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 K Q EGAEM VAAE+GG CGSSC CDPCNCK Sbjct: 44 KAQLEGAEMGVAAENGGCNCGSSCTCDPCNCK 75
BLAST of HO066667 vs. TrEMBL
Match: Q45W73_ARAHY (Type 2 metallothionein OS=Arachis hypogaea GN=MT2a PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.457e-7 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 327 KIQFEGAEMSVAAEDGGRKCGSSCXCDPCNCK 422 K QFEGAEM V+AE+GG KCGS+C CDPC CK Sbjct: 49 KAQFEGAEMGVSAENGGCKCGSNCTCDPCTCK 80 The following BLAST results are available for this feature:
BLAST of HO066667 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 5
BLAST of HO066667 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO066667 ID=HO066667; Name=HO066667; organism=Cicer arietinum; type=EST; length=467bpback to top |