EH058982
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EH058982 vs. SwissProt
Match: NIFU2_ARATH (NifU-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=NIFU2 PE=1 SV=1) HSP 1 Score: 51.2174 bits (121), Expect = 3.013e-9 Identity = 27/47 (57.45%), Postives = 31/47 (65.96%), Query Frame = -2 Query: 182 PFRTKSSNLLRRSALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 322 P R S L L R V+KAVATP+P +E+PLT ENVESVLDE Sbjct: 50 PLRRGLSRFLSSRQLFRRSKVVKAVATPDPILEVPLTEENVESVLDE 96 HSP 2 Score: 32.3426 bits (72), Expect = 3.013e-9 Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 IRPYL+SDGG VA+HE Sbjct: 97 IRPYLMSDGGNVALHE 112
BLAST of EH058982 vs. TrEMBL
Match: D7TGV2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_35.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00023274001 PE=4 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 4.165e-12 Identity = 38/65 (58.46%), Postives = 47/65 (72.31%), Query Frame = -2 Query: 182 SSATPEKGTIFF--GSNVPFRTKSSNLLRRSALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 370 SS++P K FF GS++ R S +L R+ + TR V+KAVATP+ AVELPLTAENVESVLDE Sbjct: 24 SSSSPIKIPSFFTRGSDLRRRASSRSLRIRNPIRTRSRVVKAVATPDSAVELPLTAENVESVLDE 88 HSP 2 Score: 33.4982 bits (75), Expect = 4.165e-12 Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 IRPYLISDGG VA+HE Sbjct: 89 IRPYLISDGGNVALHE 104
BLAST of EH058982 vs. TrEMBL
Match: B9SSN2_RICCO (Nitrogen fixation protein nifU, putative OS=Ricinus communis GN=RCOM_1374380 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 1.245e-10 Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = -2 Query: 182 SSATPEKGTIFFGSNVPFRTKSSNLLR---RSALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 370 SS+ P K + F + V ++L R RS TR V++AVATPN A+ELPLTAENVESVLDE Sbjct: 22 SSSRPFKSSSLFSARVSLNRGRNHLRRIPCRSVRLTRRLVVRAVATPNSALELPLTAENVESVLDE 87 HSP 2 Score: 31.9574 bits (71), Expect = 1.245e-10 Identity = 12/16 (75.00%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 +RPYLI+DGG VA+HE Sbjct: 88 VRPYLIADGGNVALHE 103
BLAST of EH058982 vs. TrEMBL
Match: B9N0C0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_827441 PE=4 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 3.690e-9 Identity = 33/64 (51.56%), Postives = 42/64 (65.62%), Query Frame = -2 Query: 182 FFGSNVPFRTKSSNLLRRS-----------ALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 340 FFG++V +S+N LRR + + R V+KAVATP+ AVELPLTA+NVESVLDE Sbjct: 36 FFGAHV----RSANQLRRGTPCHSLRARLPSFTQRRLVVKAVATPDSAVELPLTADNVESVLDE 95 HSP 2 Score: 33.113 bits (74), Expect = 3.690e-9 Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 +RPYLISDGG VA+HE Sbjct: 96 VRPYLISDGGNVALHE 111
BLAST of EH058982 vs. TrEMBL
Match: A8MS35_ARATH (AT5G49940 protein OS=Arabidopsis thaliana GN=AT5G49940 PE=2 SV=1) HSP 1 Score: 51.2174 bits (121), Expect = 5.082e-8 Identity = 27/47 (57.45%), Postives = 31/47 (65.96%), Query Frame = -2 Query: 182 PFRTKSSNLLRRSALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 322 P R S L L R V+KAVATP+P +E+PLT ENVESVLDE Sbjct: 50 PLRRGLSRFLSSRQLFRRSKVVKAVATPDPILEVPLTEENVESVLDE 96 HSP 2 Score: 32.3426 bits (72), Expect = 5.082e-8 Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 IRPYL+SDGG VA+HE Sbjct: 97 IRPYLMSDGGNVALHE 112
BLAST of EH058982 vs. TrEMBL
Match: D7MPG6_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_331396 PE=4 SV=1) HSP 1 Score: 50.447 bits (119), Expect = 8.001e-8 Identity = 27/47 (57.45%), Postives = 31/47 (65.96%), Query Frame = -2 Query: 182 PFRTKSSNLLRRSALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 322 P R S L L R V+KAVATP+P +E+PLT ENVESVLDE Sbjct: 49 PLRRGLSRSLSSRQLFRRSKVVKAVATPDPILEVPLTEENVESVLDE 95 HSP 2 Score: 32.3426 bits (72), Expect = 8.001e-8 Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 IRPYL+SDGG VA+HE Sbjct: 96 IRPYLMSDGGNVALHE 111
BLAST of EH058982 vs. TAIR peptide
Match: AT5G49940.1 (| Symbols: NFU2, ATCNFU2 | NIFU-like protein 2 | chr5:20315464-20317228 FORWARD LENGTH=235) HSP 1 Score: 51.2174 bits (121), Expect = 2.809e-10 Identity = 27/47 (57.45%), Postives = 31/47 (65.96%), Query Frame = -2 Query: 182 PFRTKSSNLLRRSALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 322 P R S L L R V+KAVATP+P +E+PLT ENVESVLDE Sbjct: 50 PLRRGLSRFLSSRQLFRRSKVVKAVATPDPILEVPLTEENVESVLDE 96 HSP 2 Score: 32.3426 bits (72), Expect = 2.809e-10 Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 IRPYL+SDGG VA+HE Sbjct: 97 IRPYLMSDGGNVALHE 112
BLAST of EH058982 vs. TAIR peptide
Match: AT5G49940.2 (| Symbols: NFU2, ATCNFU2 | NIFU-like protein 2 | chr5:20315464-20317067 FORWARD LENGTH=185) HSP 1 Score: 51.2174 bits (121), Expect = 2.844e-10 Identity = 27/47 (57.45%), Postives = 31/47 (65.96%), Query Frame = -2 Query: 182 PFRTKSSNLLRRSALSTRPFVIKAVATPNPAVELPLTAENVESVLDE 322 P R S L L R V+KAVATP+P +E+PLT ENVESVLDE Sbjct: 50 PLRRGLSRFLSSRQLFRRSKVVKAVATPDPILEVPLTEENVESVLDE 96 HSP 2 Score: 32.3426 bits (72), Expect = 2.844e-10 Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = -1 Query: 135 IRPYLISDGGKVAVHE 182 IRPYL+SDGG VA+HE Sbjct: 97 IRPYLMSDGGNVALHE 112 The following BLAST results are available for this feature:
BLAST of EH058982 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of EH058982 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 5
BLAST of EH058982 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EH058982 ID=EH058982; Name=EH058982; organism=Cicer arietinum; type=EST; length=1349bpback to top |