FE671729
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE671729 vs. TrEMBL
Match: C0IN06_CICAR (Proline-rich family protein OS=Cicer arietinum GN=PRP1 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.057e-10 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 3 Query: 378 MGGGKDKHDESDKGVFSTLAHGVPNAATHGGG 473 MGGGKDKHDESDKGVFS+LAHGV NAATHGGG Sbjct: 1 MGGGKDKHDESDKGVFSSLAHGVANAATHGGG 32
BLAST of FE671729 vs. TrEMBL
Match: C6TMW7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.704e-8 Identity = 28/34 (82.35%), Postives = 29/34 (85.29%), Query Frame = -2 Query: 2 MPYYIQRLYRLCRTSFSPNGPVSEEAVSKVCEKL 103 MPYYIQRLYRLC SFSPNGP SEEA+ KV EKL Sbjct: 1 MPYYIQRLYRLCNASFSPNGPASEEAIEKVREKL 34
BLAST of FE671729 vs. TAIR peptide
Match: AT3G58670.3 (| Symbols: | Protein of unknown function (DUF1637) | chr3:21703693-21705314 REVERSE LENGTH=242) HSP 1 Score: 50.8322 bits (120), Expect = 4.045e-7 Identity = 21/30 (70.00%), Postives = 26/30 (86.67%), Query Frame = -2 Query: 14 MPYYIQRLYRLCRTSFSPNGPVSEEAVSKV 103 MPY+IQRL+ C++S SPNGPVSEEA+ KV Sbjct: 1 MPYFIQRLFNTCKSSLSPNGPVSEEALDKV 30
BLAST of FE671729 vs. TAIR peptide
Match: AT3G58670.2 (| Symbols: | Protein of unknown function (DUF1637) | chr3:21703693-21705314 REVERSE LENGTH=242) HSP 1 Score: 50.8322 bits (120), Expect = 4.045e-7 Identity = 21/30 (70.00%), Postives = 26/30 (86.67%), Query Frame = -2 Query: 14 MPYYIQRLYRLCRTSFSPNGPVSEEAVSKV 103 MPY+IQRL+ C++S SPNGPVSEEA+ KV Sbjct: 1 MPYFIQRLFNTCKSSLSPNGPVSEEALDKV 30
BLAST of FE671729 vs. TAIR peptide
Match: AT3G58670.1 (| Symbols: | Protein of unknown function (DUF1637) | chr3:21703693-21705314 REVERSE LENGTH=242) HSP 1 Score: 50.8322 bits (120), Expect = 4.045e-7 Identity = 21/30 (70.00%), Postives = 26/30 (86.67%), Query Frame = -2 Query: 14 MPYYIQRLYRLCRTSFSPNGPVSEEAVSKV 103 MPY+IQRL+ C++S SPNGPVSEEA+ KV Sbjct: 1 MPYFIQRLFNTCKSSLSPNGPVSEEALDKV 30 The following BLAST results are available for this feature:
BLAST of FE671729 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of FE671729 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE671729 ID=FE671729; Name=FE671729; organism=Cicer arietinum; type=EST; length=473bpback to top |