FE672038
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672038 vs. TrEMBL
Match: B7FMA2_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 104.375 bits (259), Expect = 6.607e-21 Identity = 49/73 (67.12%), Postives = 55/73 (75.34%), Query Frame = -3 Query: 382 SYFSLTGGGSGQMYTTAPPVFYRCVHHMSPRTENHGNDERSSGRNIPLQRNGNSYHAQGNTGENYLIHNGNHW 600 SY S+ GGGS Q YTT PV YRCVHHMS +T NHGN ERSSGRN+ L R+G Y +Q NT +NYLIHNGN W Sbjct: 152 SYCSVNGGGSSQKYTTEQPVVYRCVHHMSQQTVNHGNMERSSGRNVLLPRSG--YQSQRNTDQNYLIHNGNRW 222
BLAST of FE672038 vs. TrEMBL
Match: C6TEL8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 5.801e-9 Identity = 41/79 (51.90%), Postives = 45/79 (56.96%), Query Frame = -3 Query: 373 SYFSLTGGG-SGQMYTTAPPVFYRCVHHMS--PRTENHGNDERSSGRNIPLQRNGNSYHAQGNTGENYLIHNGNHWQ*R 600 SY+S TG G SG+ Y V CVH MS P +SSGRN+PL R G YH GN G YLIHNGNHWQ R Sbjct: 152 SYYSPTGSGESGRRYRAPALVSDCCVHQMSQPPAYPVGMEKSKSSGRNVPLPRYG--YH-HGNGGHVYLIHNGNHWQQR 227 The following BLAST results are available for this feature:
BLAST of FE672038 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672038 ID=FE672038; Name=FE672038; organism=Cicer arietinum; type=EST; length=602bpback to top |