FE672405
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672405 vs. SwissProt
Match: CLPC_PEA (ATP-dependent Clp protease ATP-binding subunit clpC homolog, chloroplastic OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.431e-10 Identity = 37/55 (67.27%), Postives = 38/55 (69.09%), Query Frame = -2 Query: 438 RAIMRLLEDSMAEKMLAREIKEXXXXXXXXXXXXXXXVLNGSSGNPESLPEALPV 602 RAIMRLLEDSMAEKMLAREIKE VLNGSSG PESLPEAL + Sbjct: 868 RAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGKVIVLNGSSGTPESLPEALSI 922
BLAST of FE672405 vs. SwissProt
Match: CLPAB_SOLLC (ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic OS=Solanum lycopersicum GN=CD4B PE=3 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 4.292e-7 Identity = 33/56 (58.93%), Postives = 35/56 (62.50%), Query Frame = -2 Query: 438 RAIMRLLEDSMAEKMLAREIKEXXXXXXXXXXXXXXXVLNGSSGNP-ESLPEALPV 602 RAIMRLLEDSMAEKMLA EIKE VLNGSSG P + PE +PV Sbjct: 868 RAIMRLLEDSMAEKMLANEIKEGDSVIVDVDSDGNVTVLNGSSGTPSDPAPEPIPV 923
BLAST of FE672405 vs. TrEMBL
Match: A5BB92_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_010724 PE=3 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 2.204e-8 Identity = 38/56 (67.86%), Postives = 39/56 (69.64%), Query Frame = -2 Query: 438 RAIMRLLEDSMAEKMLAREIKEXXXXXXXXXXXXXXXVLNGSSG-NPESLPEALPV 602 RAIMRLLEDSMAEKMLAREIKE VLNGSSG PESLPEA+PV Sbjct: 835 RAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPPESLPEAMPV 890
BLAST of FE672405 vs. TrEMBL
Match: B9RA77_RICCO (ATP-dependent clp protease, putative OS=Ricinus communis GN=RCOM_1504150 PE=3 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.866e-7 Identity = 34/55 (61.82%), Postives = 37/55 (67.27%), Query Frame = -2 Query: 438 RAIMRLLEDSMAEKMLAREIKEXXXXXXXXXXXXXXXVLNGSSGNPESLPEALPV 602 RAIMRLLEDSMAEKMLA EIKE VLNGSSG+PE+LP+ L V Sbjct: 869 RAIMRLLEDSMAEKMLAGEIKEGDSVIVDVDSDGNVIVLNGSSGSPEALPDVLSV 923
BLAST of FE672405 vs. TAIR peptide
Match: AT5G50920.1 (| Symbols: CLPC, ATHSP93-V, HSP93-V, DCA1, CLPC1 | CLPC homologue 1 | chr5:20715710-20719800 REVERSE LENGTH=929) HSP 1 Score: 52.373 bits (124), Expect = 2.225e-7 Identity = 33/59 (55.93%), Postives = 35/59 (59.32%), Query Frame = -2 Query: 438 RAIMRLLEDSMAEKMLAREIKEXXXXXXXXXXXXXXXVLNGSSGNP----ESLPEALPV 602 RAIMRLLEDSMAEKMLAREIKE VLNG SG P E ++LPV Sbjct: 870 RAIMRLLEDSMAEKMLAREIKEGDSVIVDVDAEGNVTVLNGGSGTPTTSLEEQEDSLPV 928 The following BLAST results are available for this feature:
BLAST of FE672405 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 2
BLAST of FE672405 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of FE672405 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672405 ID=FE672405; Name=FE672405; organism=Cicer arietinum; type=EST; length=603bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|