GR407524
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR407524 vs. TrEMBL
Match: D7T8T5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00011753001 PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 2.498e-7 Identity = 28/37 (75.68%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 237 AYCGIHKPMDISEADLARKRLIFDEFFYLQVRLLFYI 347 AY GIH+P D+ EADLARKRLIFDEFFYLQ+ LF I Sbjct: 456 AYVGIHQPKDLKEADLARKRLIFDEFFYLQLGRLFQI 492
BLAST of GR407524 vs. TAIR peptide
Match: AT2G01440.1 (| Symbols: | DEAD/DEAH box RNA helicase family protein | chr2:193950-199056 REVERSE LENGTH=973) HSP 1 Score: 55.4546 bits (132), Expect = 3.991e-8 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 3 Query: 237 AYCGIHKPMDISEADLARKRLIFDEFFYLQVRLLF 341 AY GIH+P + EADLARKRLIFDEFFYLQ+ L+ Sbjct: 441 AYVGIHEPKTLDEADLARKRLIFDEFFYLQLARLY 475 The following BLAST results are available for this feature:
BLAST of GR407524 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of GR407524 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR407524 ID=GR407524; Name=GR407524; organism=Cicer arietinum; type=EST; length=780bpback to top |