GR395779
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR395779 vs. TrEMBL
Match: C6SYN8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 1.430e-13 Identity = 36/44 (81.82%), Postives = 39/44 (88.64%), Query Frame = 2 Query: 104 CRWTKSSWAFLNEPPMIEAAPNKYAAQFHVANLGSSKLNPGDEI 235 C WTKSSWAFLNEPP+IEAA NKYA+QF VANLGS+K NPGD I Sbjct: 94 CWWTKSSWAFLNEPPVIEAASNKYASQFQVANLGSTKFNPGDGI 137
BLAST of GR395779 vs. TrEMBL
Match: C6T390_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.439e-13 Identity = 36/42 (85.71%), Postives = 39/42 (92.86%), Query Frame = 2 Query: 110 WTKSSWAFLNEPPMIEAAPNKYAAQFHVANLGSSKLNPGDEI 235 WTKSSWAFLNEPP+IEAA NKYA+QFHVANLGS+KLNP D I Sbjct: 101 WTKSSWAFLNEPPVIEAASNKYASQFHVANLGSTKLNPEDGI 142
BLAST of GR395779 vs. TrEMBL
Match: C6T3M6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 1.531e-7 Identity = 25/34 (73.53%), Postives = 29/34 (85.29%), Query Frame = 2 Query: 110 WTKSSWAFLNEPPMIEAAPNKYAAQFHVANLGSS 211 WTKSSWAFLNEPP+ EA NKY +QFHV ++GSS Sbjct: 101 WTKSSWAFLNEPPVTEAVSNKYKSQFHVTSMGSS 134 The following BLAST results are available for this feature:
BLAST of GR395779 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR395779 ID=GR395779; Name=GR395779; organism=Cicer arietinum; type=EST; length=696bpback to top |