GR912185
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR912185 vs. SwissProt
Match: YO052_YEAST (AN1-type zinc finger protein YOR052C OS=Saccharomyces cerevisiae GN=YOR052C PE=1 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 3.894e-7 Identity = 19/40 (47.50%), Postives = 27/40 (67.50%), Query Frame = -2 Query: 27 KRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKC 146 K+ C +C +A + +GDC F +GHFC KHRL+E+H C Sbjct: 81 KKNACYFDTCSSAASKFIGDCNFCKGHFCSKHRLMENHAC 120
BLAST of GR912185 vs. TrEMBL
Match: C7YRL6_NECH7 (Predicted protein OS=Nectria haematococca (strain 77-13-4 / FGSC 9596 / MPVI) GN=NECHADRAFT_73691 PE=4 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 6.924e-18 Identity = 40/44 (90.91%), Postives = 41/44 (93.18%), Query Frame = -2 Query: 24 MPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKCT 155 MPPKRIRCTAA CRE AQRIVGDC+F QGHFCGKHRLLEDHKCT Sbjct: 1 MPPKRIRCTAAQCREPAQRIVGDCSFCQGHFCGKHRLLEDHKCT 44
BLAST of GR912185 vs. TrEMBL
Match: Q0U899_PHANO (Putative uncharacterized protein OS=Phaeosphaeria nodorum GN=SNOG_12015 PE=4 SV=2) HSP 1 Score: 78.9518 bits (193), Expect = 1.765e-13 Identity = 31/43 (72.09%), Postives = 37/43 (86.05%), Query Frame = -2 Query: 27 MPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKC 155 MPPK+IRC+ C+++AQRIVGDC F GH+CGKHRLLEDHKC Sbjct: 100 MPPKKIRCSFKECKDAAQRIVGDCGFCSGHYCGKHRLLEDHKC 142
BLAST of GR912185 vs. TrEMBL
Match: B6H522_PENCW (Pc13g11890 protein OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=Pc13g11890 PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.818e-11 Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = -2 Query: 24 MPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKCT 155 MPP++ RC C+E+AQRIVGDC+F GHFC KHR+LE H CT Sbjct: 1 MPPRKPRCNFKECKEAAQRIVGDCSFCAGHFCSKHRMLEAHSCT 44
BLAST of GR912185 vs. TrEMBL
Match: B2VXM8_PYRTR (AN1-type zinc finger protein OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_03274 PE=4 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 4.806e-11 Identity = 28/43 (65.12%), Postives = 33/43 (76.74%), Query Frame = -2 Query: 27 MPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKC 155 MPPK+IRC+ C++ AQ IVGDC F GH C KHR+LEDHKC Sbjct: 100 MPPKKIRCSFKDCKDRAQPIVGDCGFCDGHHCSKHRMLEDHKC 142
BLAST of GR912185 vs. TrEMBL
Match: A7E6F6_SCLS1 (Putative uncharacterized protein OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_00881 PE=4 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 4.806e-11 Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = -2 Query: 27 SRTCSVHLSEVYFFHKFNKTNNAMPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKC 224 S S ++++ H MPPK+I+C C +AQRIVG C F +G FCGKHR+LEDHKC Sbjct: 75 STLTSNNITQDSTIHVAGTLRGGMPPKKIKCNYKDCGVAAQRIVGHCGFCEGEFCGKHRMLEDHKC 140
BLAST of GR912185 vs. TrEMBL
Match: A6S7C5_BOTFB (Predicted protein OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_09008 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.398e-10 Identity = 28/52 (53.85%), Postives = 34/52 (65.38%), Query Frame = -2 Query: 27 HKFNKTNNAMPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKC 182 H MPP++I+C C +AQRIVG C F +G FCGKHR+LEDHKC Sbjct: 89 HVAGTLRGGMPPRKIKCNYKDCGVAAQRIVGHCGFCEGEFCGKHRMLEDHKC 140
BLAST of GR912185 vs. TrEMBL
Match: Q5BFK3_EMENI (Putative uncharacterized protein OS=Emericella nidulans GN=AN0677.2 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.826e-10 Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = -2 Query: 24 MPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKCT 155 M P++ RC C+E+AQRIVGDC+F GHFC KHR+LE H CT Sbjct: 1 MAPRKPRCNFKECKEAAQRIVGDCSFCNGHFCSKHRMLEAHSCT 44
BLAST of GR912185 vs. TrEMBL
Match: D5GB50_9PEZI (Whole genome shotgun sequence assembly, scaffold_19, strain Mel28 OS=Tuber melanosporum GN=GSTUM_00005449001 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.826e-10 Identity = 34/71 (47.89%), Postives = 42/71 (59.15%), Query Frame = -2 Query: 24 LKDSRTCS-VHLSEVYFFHKFNKTNNAMPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKCT 233 L+D RT S ++ + H + P K+I C C AQRIVGDC F GH+CGKHRLLEDHKC+ Sbjct: 109 LEDGRTLSDYNIQKESTLHLVLRLRGGAPKKKI-CNFKECTTPAQRIVGDCRFCDGHYCGKHRLLEDHKCS 178
BLAST of GR912185 vs. TrEMBL
Match: C8VRR8_EMENI (Putative uncharacterized protein OS=Aspergillus nidulans FGSC A4 GN=ANIA_00677 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.826e-10 Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = -2 Query: 24 MPPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKCT 155 M P++ RC C+E+AQRIVGDC+F GHFC KHR+LE H CT Sbjct: 1 MAPRKPRCNFKECKEAAQRIVGDCSFCNGHFCSKHRMLEAHSCT 44
BLAST of GR912185 vs. TrEMBL
Match: C5K1C1_AJEDS (Zinc finger protein OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_08615 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.826e-10 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = -2 Query: 24 PPKRIRCTAASCRESAQRIVGDCTFSQGHFCGKHRLLEDHKCT 152 PP++ RC C+E AQRIVGDC F GHFCGKHR+LE H C+ Sbjct: 3 PPRKPRCNFKDCKELAQRIVGDCGFCNGHFCGKHRMLESHACS 45 The following BLAST results are available for this feature:
BLAST of GR912185 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of GR912185 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR912185 ID=GR912185; Name=GR912185; organism=Cicer arietinum; type=EST; length=390bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|