CK148738
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK148738 vs. SwissProt
Match: PUB17_ARATH (U-box domain-containing protein 17 OS=Arabidopsis thaliana GN=PUB17 PE=1 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 1.575e-10 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 2 Query: 170 TLEAFLAPVDLSDVSLVQTLMAGGERACVLFFKASFFFQRKNSRTLIRK 316 +LEAFLAPVDLS V+LVQTL + F F FQRKN+R+LIRK Sbjct: 17 SLEAFLAPVDLSGVALVQTLASISSEVVSCFTSVRFSFQRKNARSLIRK 65 HSP 2 Score: 25.409 bits (54), Expect = 1.575e-10 Identity = 12/13 (92.31%), Postives = 12/13 (92.31%), Query Frame = 1 Query: 124 MASGAIFSSLRRR 162 MAS AIFSSLRRR Sbjct: 1 MASAAIFSSLRRR 13 HSP 3 Score: 24.2534 bits (51), Expect = 1.575e-10 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 1 Query: 382 MLCLKELYFVVVWWQDIIDY 441 +LCLKELY ++ + ++DY Sbjct: 104 LLCLKELYLLLYRSKILVDY 123
BLAST of CK148738 vs. TrEMBL
Match: B7FM68_MEDTR (Putative uncharacterized protein (Fragment) OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.600e-9 Identity = 34/49 (69.39%), Postives = 38/49 (77.55%), Query Frame = 2 Query: 170 TLEAFLAPVDLSDVSLVQTLMAGGERACVLFFKASFFFQRKNSRTLIRK 316 TLEAFLAPVDLSDV+LVQTL+ F K SFFFQRKN+R+LIRK Sbjct: 17 TLEAFLAPVDLSDVALVQTLVTVVNELVCCFSKRSFFFQRKNTRSLIRK 65
BLAST of CK148738 vs. TrEMBL
Match: B9S8E7_RICCO (Ubiquitin-protein ligase, putative OS=Ricinus communis GN=RCOM_1251990 PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.363e-8 Identity = 31/49 (63.27%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 170 TLEAFLAPVDLSDVSLVQTLMAGGERACVLFFKASFFFQRKNSRTLIRK 316 +LEAFLAPVDL+DV+LVQTL++ F S FFQRKNSR+LIRK Sbjct: 17 SLEAFLAPVDLTDVALVQTLVSVSTELVACFSGKSMFFQRKNSRSLIRK 65
BLAST of CK148738 vs. TrEMBL
Match: D7KDS9_ARALY (Plant U-box17 OS=Arabidopsis lyrata subsp. lyrata GN=PUB17 PE=4 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 9.446e-8 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 2 Query: 170 TLEAFLAPVDLSDVSLVQTLMAGGERACVLFFKASFFFQRKNSRTLIRK 316 +LEAFLAPVDLS V+LVQTL + F F FQRKN+R+LIRK Sbjct: 17 SLEAFLAPVDLSGVALVQTLASISTEVVSCFTSVRFSFQRKNARSLIRK 65 HSP 2 Score: 25.409 bits (54), Expect = 9.446e-8 Identity = 12/13 (92.31%), Postives = 12/13 (92.31%), Query Frame = 1 Query: 124 MASGAIFSSLRRR 162 MAS AIFSSLRRR Sbjct: 1 MASAAIFSSLRRR 13
BLAST of CK148738 vs. TrEMBL
Match: B9I1H0_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_235193 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.426e-7 Identity = 31/49 (63.27%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 170 TLEAFLAPVDLSDVSLVQTLMAGGERACVLFFKASFFFQRKNSRTLIRK 316 +LEAFLAPVDL+DV+LVQTL++ F S FFQRKNSR+LIRK Sbjct: 17 SLEAFLAPVDLTDVALVQTLVSVSTELVSCFSGKSLFFQRKNSRSLIRK 65
BLAST of CK148738 vs. TAIR peptide
Match: AT1G29340.1 (| Symbols: PUB17, ATPUB17 | plant U-box 17 | chr1:10264412-10266601 FORWARD LENGTH=729) HSP 1 Score: 54.6842 bits (130), Expect = 1.811e-11 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 2 Query: 170 TLEAFLAPVDLSDVSLVQTLMAGGERACVLFFKASFFFQRKNSRTLIRK 316 +LEAFLAPVDLS V+LVQTL + F F FQRKN+R+LIRK Sbjct: 17 SLEAFLAPVDLSGVALVQTLASISSEVVSCFTSVRFSFQRKNARSLIRK 65 HSP 2 Score: 25.409 bits (54), Expect = 1.811e-11 Identity = 12/13 (92.31%), Postives = 12/13 (92.31%), Query Frame = 1 Query: 124 MASGAIFSSLRRR 162 MAS AIFSSLRRR Sbjct: 1 MASAAIFSSLRRR 13 HSP 3 Score: 24.2534 bits (51), Expect = 1.811e-11 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 1 Query: 382 MLCLKELYFVVVWWQDIIDY 441 +LCLKELY ++ + ++DY Sbjct: 104 LLCLKELYLLLYRSKILVDY 123 The following BLAST results are available for this feature:
BLAST of CK148738 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of CK148738 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
BLAST of CK148738 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK148738 ID=CK148738; Name=CK148738; organism=Cicer arietinum; type=EST; length=460bpback to top |