GR396881
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR396881 vs. TrEMBL
Match: B7FIK2_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.008e-9 Identity = 30/33 (90.91%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 D ESET RPLDMHHGMEVRLGLSKGPVYPSII Sbjct: 110 DSRESETFRPLDMHHGMEVRLGLSKGPVYPSII 142
BLAST of GR396881 vs. TrEMBL
Match: Q9FYG8_ARATH (F1N21.7 OS=Arabidopsis thaliana PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.460e-8 Identity = 24/33 (72.73%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP +SET +P+D HHGMEVRLG+SKGP+YPS I Sbjct: 109 DPRDSETFKPVDFHHGMEVRLGISKGPIYPSFI 141
BLAST of GR396881 vs. TrEMBL
Match: D7KV10_ARALY (Proteasome maturation factor UMP1 family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_894453 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.102e-7 Identity = 24/33 (72.73%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP +SET +P+D HHGMEVRLG+SKGPVYPS + Sbjct: 109 DPRDSETFKPVDFHHGMEVRLGISKGPVYPSFM 141
BLAST of GR396881 vs. TrEMBL
Match: Q94B05_ARATH (At1g67250 OS=Arabidopsis thaliana GN=At1g67250/F1N21_7 PE=2 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.439e-7 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP +SET +P+D HHGMEVRLG+SKGP+YPS + Sbjct: 109 DPRDSETFKPVDFHHGMEVRLGISKGPIYPSFM 141
BLAST of GR396881 vs. TrEMBL
Match: D7MJW5_ARALY (Proteasome maturation factor UMP1 family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_916462 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.439e-7 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP ESETL+P+D HHGMEVRLGLSKGPV PS + Sbjct: 109 DPRESETLKPVDFHHGMEVRLGLSKGPVPPSFM 141
BLAST of GR396881 vs. TrEMBL
Match: Q9FFV7_ARATH (Gb|AAB95243.1 OS=Arabidopsis thaliana GN=At5g38650 PE=2 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.206e-7 Identity = 25/33 (75.76%), Postives = 28/33 (84.85%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP ESETL+P+D HHGMEVRLGLSKGP PS + Sbjct: 109 DPRESETLKPVDFHHGMEVRLGLSKGPASPSFM 141
BLAST of GR396881 vs. TAIR peptide
Match: AT1G67250.1 (| Symbols: | Proteasome maturation factor UMP1 | chr1:25163808-25164967 REVERSE LENGTH=141) HSP 1 Score: 59.3066 bits (142), Expect = 5.663e-10 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP +SET +P+D HHGMEVRLG+SKGP+YPS + Sbjct: 109 DPRDSETFKPVDFHHGMEVRLGISKGPIYPSFM 141
BLAST of GR396881 vs. TAIR peptide
Match: AT5G38660.2 (| Symbols: APE1 | acclimation of photosynthesis to environment | chr5:15471208-15475497 REVERSE LENGTH=431) HSP 1 Score: 58.151 bits (139), Expect = 1.262e-9 Identity = 25/33 (75.76%), Postives = 28/33 (84.85%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP ESETL+P+D HHGMEVRLGLSKGP PS + Sbjct: 399 DPRESETLKPVDFHHGMEVRLGLSKGPASPSFM 431
BLAST of GR396881 vs. TAIR peptide
Match: AT5G38650.1 (| Symbols: | Proteasome maturation factor UMP1 | chr5:15471208-15472699 REVERSE LENGTH=141) HSP 1 Score: 58.151 bits (139), Expect = 1.262e-9 Identity = 25/33 (75.76%), Postives = 28/33 (84.85%), Query Frame = 1 Query: 1 DPHESETLRPLDMHHGMEVRLGLSKGPVYPSII 99 DP ESETL+P+D HHGMEVRLGLSKGP PS + Sbjct: 109 DPRESETLKPVDFHHGMEVRLGLSKGPASPSFM 141 The following BLAST results are available for this feature:
BLAST of GR396881 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 6
BLAST of GR396881 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR396881 ID=GR396881; Name=GR396881; organism=Cicer arietinum; type=EST; length=291bpback to top |