GR407378
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR407378 vs. SwissProt
Match: RL18_CICAR (60S ribosomal protein L18 (Fragment) OS=Cicer arietinum GN=RPL18 PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.072e-15 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV Sbjct: 148 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 183
BLAST of GR407378 vs. SwissProt
Match: RL182_ARATH (60S ribosomal protein L18-2 OS=Arabidopsis thaliana GN=RPL18B PE=2 SV=2) HSP 1 Score: 74.7146 bits (182), Expect = 1.632e-13 Identity = 32/36 (88.89%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSH+KPYVR+KGRKFEKARG+RKSRGF+V Sbjct: 152 GPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV 187
BLAST of GR407378 vs. SwissProt
Match: RL183_ARATH (60S ribosomal protein L18-3 OS=Arabidopsis thaliana GN=RPL18C PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.200e-13 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHS+TKPYVR KGRKFEKARG+RKSRGF+V Sbjct: 152 GPAPGVPHSNTKPYVRHKGRKFEKARGKRKSRGFKV 187
BLAST of GR407378 vs. SwissProt
Match: RL18_IXOSC (60S ribosomal protein L18 OS=Ixodes scapularis GN=RpL18 PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.381e-12 Identity = 31/35 (88.57%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFR 105 GPAPGVPHSHTKPYVRSKGRKFE+ARGRRKSR ++ Sbjct: 153 GPAPGVPHSHTKPYVRSKGRKFERARGRRKSRRYK 187
BLAST of GR407378 vs. SwissProt
Match: RL18_CAEEL (60S ribosomal protein L18 OS=Caenorhabditis elegans GN=rpl-18 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.019e-12 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFR 105 GPAPGVPHSHTKPYVRSKGRKFE+ARGRR SR ++ Sbjct: 153 GPAPGVPHSHTKPYVRSKGRKFERARGRRASRAYK 187
BLAST of GR407378 vs. SwissProt
Match: RL18_LYSTE (60S ribosomal protein L18 OS=Lysiphlebus testaceipes GN=RpL18 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.169e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFR 105 GPAPGVPHSHTKP VRSKGRKFE+ARGRRKS G++ Sbjct: 153 GPAPGVPHSHTKPLVRSKGRKFERARGRRKSCGYK 187
BLAST of GR407378 vs. SwissProt
Match: RL18_CAEBR (60S ribosomal protein L18 OS=Caenorhabditis briggsae GN=rpl-18 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.527e-11 Identity = 29/35 (82.86%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFR 105 GPAPGVPHSHTKP+VRSKGRKFE+ARGRR SR ++ Sbjct: 153 GPAPGVPHSHTKPHVRSKGRKFERARGRRASRAYK 187
BLAST of GR407378 vs. SwissProt
Match: RL18_RAT (60S ribosomal protein L18 OS=Rattus norvegicus GN=Rpl18 PE=2 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 1.995e-11 Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFR 105 G APG PHSHTKPYVRSKGRKFE+ARGRR SRG++ Sbjct: 153 GKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYK 187
BLAST of GR407378 vs. SwissProt
Match: RL18_MOUSE (60S ribosomal protein L18 OS=Mus musculus GN=Rpl18 PE=2 SV=3) HSP 1 Score: 67.781 bits (164), Expect = 1.995e-11 Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFR 105 G APG PHSHTKPYVRSKGRKFE+ARGRR SRG++ Sbjct: 153 GKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYK 187
BLAST of GR407378 vs. SwissProt
Match: RL18_MACFA (60S ribosomal protein L18 OS=Macaca fascicularis GN=RPL18 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.995e-11 Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFR 105 G APG PHSHTKPYVRSKGRKFE+ARGRR SRG++ Sbjct: 153 GKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYK 187
BLAST of GR407378 vs. TrEMBL
Match: D4P866_LINUS (Putative ribosomal protein L18 (Fragment) OS=Linum usitatissimum PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 3.967e-13 Identity = 35/36 (97.22%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFEKARGRR SRGFRV Sbjct: 119 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV 154
BLAST of GR407378 vs. TrEMBL
Match: A6N9Y7_ORNPR (Ribosomal protein L18 OS=Ornithodoros parkeri PE=2 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.181e-13 Identity = 34/36 (94.44%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFE+ARGRRKSRGF+V Sbjct: 153 GPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV 188
BLAST of GR407378 vs. TrEMBL
Match: C5X5J2_SORBI (Ribosomal protein L18 OS=Sorghum bicolor GN=Sb02g042750 PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.838e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFEKARGRR SRGF+V Sbjct: 152 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV 187
BLAST of GR407378 vs. TrEMBL
Match: C5X0Q5_SORBI (Ribosomal protein L18 OS=Sorghum bicolor GN=Sb01g035860 PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.838e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFEKARGRR SRGF+V Sbjct: 152 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV 187
BLAST of GR407378 vs. TrEMBL
Match: C4J2T3_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.838e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFEKARGRR SRGF+V Sbjct: 99 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV 134
BLAST of GR407378 vs. TrEMBL
Match: B9RFD6_RICCO (60S ribosomal protein L18, putative OS=Ricinus communis GN=RCOM_1433890 PE=4 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.838e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFE+ARGRR SRGFRV Sbjct: 368 GPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV 403
BLAST of GR407378 vs. TrEMBL
Match: B6SJ08_MAIZE (Ribosomal protein L18 OS=Zea mays PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.838e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFEKARGRR SRGF+V Sbjct: 152 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV 187
BLAST of GR407378 vs. TrEMBL
Match: B4FCY7_MAIZE (Putative uncharacterized protein OS=Zea mays PE=4 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.838e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVRSKGRKFEKARGRR SRGF+V Sbjct: 56 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV 91
BLAST of GR407378 vs. TrEMBL
Match: D7L3W4_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_477850 PE=4 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.969e-12 Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSH+KPYVR KGRKFEKARGRRKSRGF+V Sbjct: 152 GPAPGVPHSHSKPYVRGKGRKFEKARGRRKSRGFKV 187
BLAST of GR407378 vs. TrEMBL
Match: C6T531_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.969e-12 Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVR+KGRKFE+ARGRR SRGFRV Sbjct: 152 GPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV 187
BLAST of GR407378 vs. TAIR peptide
Match: AT3G05590.1 (| Symbols: RPL18 | ribosomal protein L18 | chr3:1621511-1622775 FORWARD LENGTH=187) HSP 1 Score: 74.7146 bits (182), Expect = 1.295e-14 Identity = 32/36 (88.89%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSH+KPYVR+KGRKFEKARG+RKSRGF+V Sbjct: 152 GPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV 187
BLAST of GR407378 vs. TAIR peptide
Match: AT5G27850.1 (| Symbols: | Ribosomal protein L18e/L15 superfamily protein | chr5:9873169-9874297 FORWARD LENGTH=187) HSP 1 Score: 72.7886 bits (177), Expect = 4.920e-14 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHS+TKPYVR KGRKFEKARG+RKSRGF+V Sbjct: 152 GPAPGVPHSNTKPYVRHKGRKFEKARGKRKSRGFKV 187
BLAST of GR407378 vs. TAIR peptide
Match: AT2G47570.2 (| Symbols: | Ribosomal protein L18e/L15 superfamily protein | chr2:19515898-19516717 REVERSE LENGTH=135) HSP 1 Score: 67.0106 bits (162), Expect = 2.700e-12 Identity = 29/36 (80.56%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVR G+K E ARGRR+SRGF+V Sbjct: 100 GPAPGVPHSHTKPYVRQTGKKIEIARGRRRSRGFKV 135
BLAST of GR407378 vs. TAIR peptide
Match: AT2G47570.1 (| Symbols: | Ribosomal protein L18e/L15 superfamily protein | chr2:19515898-19516717 REVERSE LENGTH=135) HSP 1 Score: 67.0106 bits (162), Expect = 2.700e-12 Identity = 29/36 (80.56%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 1 GPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV 108 GPAPGVPHSHTKPYVR G+K E ARGRR+SRGF+V Sbjct: 100 GPAPGVPHSHTKPYVRQTGKKIEIARGRRRSRGFKV 135 The following BLAST results are available for this feature:
BLAST of GR407378 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 10
BLAST of GR407378 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR407378 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR407378 ID=GR407378; Name=GR407378; organism=Cicer arietinum; type=EST; length=333bpback to top |