DY475126
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY475126 vs. TrEMBL
Match: B9RNB0_RICCO (Nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_1346320 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.699e-12 Identity = 36/50 (72.00%), Postives = 39/50 (78.00%), Query Frame = 1 Query: 106 YKEYTGPPGSGSVVNNNNPQERLNPKKRSNAGSDEEDEIRDPNAVPTDFT 255 YKEYTGPPGS + NN Q+R KRS+AGSDEEDE RDPNAVPTDFT Sbjct: 17 YKEYTGPPGSSTA---NNTQDRSKANKRSHAGSDEEDEPRDPNAVPTDFT 63
BLAST of DY475126 vs. TrEMBL
Match: B7FKP4_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.694e-11 Identity = 35/49 (71.43%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 106 YKEYTGPPGSGSVVNNNNPQERLNPKKRSNAGSDEEDEIRDPNAVPTDF 252 YKEYTGP GSGSV QER KRSNAGSDEEDE+RDPNA+PT F Sbjct: 17 YKEYTGPAGSGSV------QERAKSNKRSNAGSDEEDEVRDPNAIPTGF 59
BLAST of DY475126 vs. TrEMBL
Match: D7U2K7_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_5.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00028150001 PE=4 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.006e-8 Identity = 31/50 (62.00%), Postives = 36/50 (72.00%), Query Frame = 1 Query: 106 YKEYTGPPGSGSVVNNNNPQERLNPKKRSNAGSDEEDEIRDPNAVPTDFT 255 YKEYTGPP S +N Q++ KRS+A SDEE+E RDPNAVPTDFT Sbjct: 54 YKEYTGPPRS----TTSNVQDKAKTSKRSHASSDEEEEPRDPNAVPTDFT 99
BLAST of DY475126 vs. TrEMBL
Match: B9I9G6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_774679 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.520e-8 Identity = 31/50 (62.00%), Postives = 37/50 (74.00%), Query Frame = 1 Query: 106 YKEYTGPPGSGSVVNNNNPQERLNPKKRSNAGSDEEDEIRDPNAVPTDFT 255 YKEYTGPPGS VN+ + ++N KRS+ SDEE+E DPNAVPTDFT Sbjct: 17 YKEYTGPPGS--TVNSAHDMAKIN--KRSHVDSDEEEETPDPNAVPTDFT 62
BLAST of DY475126 vs. TrEMBL
Match: B9GSW0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_710316 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.520e-8 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 106 YKEYTGPPGSGSVVNNNNPQERLNPKKRSNAGSDEEDEIRDPNAVPTDFT 255 YKEYTGPP S V+N + +E++N KRS+ SDEE+E DPNAVPTDFT Sbjct: 17 YKEYTGPPSS--TVSNAHDREKVN--KRSHVDSDEEEETPDPNAVPTDFT 62
BLAST of DY475126 vs. TAIR peptide
Match: AT3G62330.1 (| Symbols: | Zinc knuckle (CCHC-type) family protein | chr3:23063329-23065419 REVERSE LENGTH=479) HSP 1 Score: 53.1434 bits (126), Expect = 4.049e-8 Identity = 30/52 (57.69%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 106 YKEYTGPPGSGSVVNNNNPQERLNP-KKRSNAGSDEEDE-IRDPNAVPTDFT 255 YKEYTGP S V NNN Q++ P K+RS DEE+E + DPN+VPTDFT Sbjct: 18 YKEYTGP---ASAVTNNNIQDKDKPVKQRSEERCDEEEEQLPDPNSVPTDFT 66 The following BLAST results are available for this feature:
BLAST of DY475126 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 5
BLAST of DY475126 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY475126 ID=DY475126; Name=DY475126; organism=Cicer arietinum; type=EST; length=255bpback to top |