DY475449
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY475449 vs. SwissProt
Match: C71AI_ARATH (Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 1.505e-11 Identity = 34/68 (50.00%), Postives = 46/68 (67.65%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 H+ DFVNILLSI E E + + R +IK ++LDM + GI TSST++EW ++ELIR+P MK L Sbjct: 262 HKADFVNILLSI-----EKEKNNGFKVQRNDIKFMILDMFIGGISTSSTLLEWIMTELIRNPECMKKL 324
BLAST of DY475449 vs. SwissProt
Match: C71A8_MENPI (Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.568e-11 Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 3 Query: 57 EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 E+FV+ILL I N + IDR +IKAI+LD+ AG DT++ V+EWA++EL+RHP +MK L Sbjct: 274 ENFVDILLEIYRN-----NSAGVSIDRDSIKAIILDVFAAGTDTTAVVLEWAMTELLRHPEIMKKL 334
BLAST of DY475449 vs. SwissProt
Match: C71AC_ARATH (Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.757e-11 Identity = 34/68 (50.00%), Postives = 45/68 (66.18%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 H+EDFV+ILLSI E E R +IK ++LDM + G TSST++EW ++ELIR+P VMK L Sbjct: 262 HKEDFVDILLSI-----ESEKSIGFQAQRDDIKFMILDMFIGGTSTSSTLLEWIMTELIRNPNVMKKL 324
BLAST of DY475449 vs. SwissProt
Match: C71AQ_ARATH (Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 8.260e-10 Identity = 31/66 (46.97%), Postives = 49/66 (74.24%), Query Frame = 3 Query: 60 DFVNILLSIMH-QPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 DFV++LL+I + + FE I+R +IKAI++++ V G DTSST++EWA++EL+RHP+ +K L Sbjct: 258 DFVDVLLAIQRDKTVGFE------INRVSIKAIVMNVFVGGTDTSSTLMEWAMTELLRHPKCLKRL 317
BLAST of DY475449 vs. SwissProt
Match: C71BW_ARATH (Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 1.079e-9 Identity = 31/66 (46.97%), Postives = 47/66 (71.21%), Query Frame = 3 Query: 57 EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 EDFV++LL + + N+ + R +IKAILLD+++AGIDTS+ + WA++EL R+PRVMK + Sbjct: 264 EDFVDLLLRLEKEEAVLGNDK---LTRNHIKAILLDVLLAGIDTSAITMTWAMTELARNPRVMKKV 326
BLAST of DY475449 vs. SwissProt
Match: C71B6_ARATH (Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 1.409e-9 Identity = 28/67 (41.79%), Postives = 45/67 (67.16%), Query Frame = 3 Query: 54 REDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 RED +++LL + Q + + I T+I+AI++D+ VAG+DTS ++W ++EL RHPRVMK + Sbjct: 270 REDLIDVLLKLQSQETKLGSSR---ITDTHIRAIIMDLFVAGVDTSVITLDWTMAELSRHPRVMKKV 333
BLAST of DY475449 vs. SwissProt
Match: C71AN_ARATH (Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 1.409e-9 Identity = 30/67 (44.78%), Postives = 43/67 (64.18%), Query Frame = 3 Query: 54 REDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 + DFV++LL+ + IDR +IKAI+LD V G DTSST++EW ++EL+RHP +K L Sbjct: 254 KTDFVDVLLAAQR-----DKSFGFDIDRLSIKAIVLDAFVGGTDTSSTLVEWEMTELLRHPTCLKKL 315
BLAST of DY475449 vs. SwissProt
Match: C71A6_NEPRA (Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 3.139e-9 Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 3 Query: 60 DFVNILLSIMHQPIEFENEHNLI-IDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 DFV++LL ENE + +D IKA++LDM +AG DT+ T +EWALSELI++PR MK L Sbjct: 277 DFVDLLLQFQR-----ENERSSSPVDDLTIKAVILDMFLAGTDTTVTALEWALSELIKNPRAMKIL 337
BLAST of DY475449 vs. SwissProt
Match: C71AL_ARATH (Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 4.099e-9 Identity = 32/68 (47.06%), Postives = 47/68 (69.12%), Query Frame = 3 Query: 54 REDFVNILLSIMHQP-IEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 R DFV++LL I + I FE IDR IKAI+LD++VAG D+S +++WA++EL+RHP ++ L Sbjct: 257 RTDFVDVLLRIQREKSIGFE------IDRLCIKAIVLDVLVAGTDSSYALMDWAMTELLRHPECLRTL 318
BLAST of DY475449 vs. SwissProt
Match: C71BV_ARATH (Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 9.132e-9 Identity = 28/66 (42.42%), Postives = 47/66 (71.21%), Query Frame = 3 Query: 57 EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 EDFV++LL + + N+ + R +IKAIL+D+++AG+DTS+ + WA++EL ++PRVMK + Sbjct: 265 EDFVDLLLRLEKEEAVLGNDK---LTRNHIKAILMDVLLAGMDTSAITMTWAMAELAKNPRVMKKV 327
BLAST of DY475449 vs. TrEMBL
Match: D7SIX3_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00008262001 PE=4 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 4.232e-15 Identity = 39/68 (57.35%), Postives = 52/68 (76.47%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 + +F++I+LS+M +E + IIDRTN+KAILLDM+V GID+SST IEW SEL+RHPRVM+ L Sbjct: 766 NHSNFIDIMLSLMSNFSNLRSESSYIIDRTNVKAILLDMLVGGIDSSSTTIEWVFSELLRHPRVMRQL 833 HSP 2 Score: 75.485 bits (184), Expect = 1.966e-12 Identity = 34/65 (52.31%), Postives = 49/65 (75.38%), Query Frame = 3 Query: 60 DFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 +F++++LS+M++ +E+E IDR N+KAI+LD + G DTS T IEW LSEL+RHPRVM+ L Sbjct: 120 NFIDVVLSLMNKSNNYEDESLYAIDRKNVKAIILDALAGGTDTSITSIEWILSELLRHPRVMRQL 184 HSP 3 Score: 70.8626 bits (172), Expect = 4.842e-11 Identity = 31/60 (51.67%), Postives = 49/60 (81.67%), Query Frame = 3 Query: 60 DFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPR 239 +F++I+LS+M + +F++E IDRTN+KAI+LD++V GID+S ++WAL+EL+RHPR Sbjct: 453 NFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIILDILVGGIDSSLISVDWALAELLRHPR 512
BLAST of DY475449 vs. TrEMBL
Match: A5B160_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_033535 PE=4 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 9.429e-15 Identity = 38/68 (55.88%), Postives = 52/68 (76.47%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 + +F++I+LS+M +E + IIDRTN+KAI+LDM+V GID+SST IEW SEL+RHPRVM+ L Sbjct: 259 NHSNFIDIMLSLMSNFSNLRSESSYIIDRTNVKAIVLDMLVGGIDSSSTTIEWVFSELLRHPRVMRQL 326
BLAST of DY475449 vs. TrEMBL
Match: Q8W228_PYRCO (Cytochrome P450 OS=Pyrus communis PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.778e-13 Identity = 36/68 (52.94%), Postives = 50/68 (73.53%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 H +DFV++LLS +HQ ++ +E +++RTN KA LLDMI DTS+T I W L+EL+RHP+VMK L Sbjct: 264 HHKDFVDVLLSSIHQTLKPNDEEVYMLERTNAKATLLDMIAGAFDTSATAIIWTLAELLRHPKVMKRL 331
BLAST of DY475449 vs. TrEMBL
Match: D7SIX4_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00008264001 PE=4 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.825e-13 Identity = 34/68 (50.00%), Postives = 51/68 (75.00%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 + +DFV+++LS+M++ F E + +I++ NIK I+ D+I+ IDTS+T IEW LSEL RHPRVM+ L Sbjct: 116 NHKDFVDVMLSLMNEMKNFHQEPSYLIEQENIKGIVWDIIIGAIDTSATTIEWLLSELFRHPRVMRQL 183
BLAST of DY475449 vs. TrEMBL
Match: B9RE29_RICCO (Flavonoid 3-hydroxylase, putative OS=Ricinus communis GN=RCOM_1617460 PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 8.825e-13 Identity = 37/67 (55.22%), Postives = 51/67 (76.12%), Query Frame = 3 Query: 54 REDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 + DFV+ LLS+++Q + + IDR+NIKAIL+D+IVA +DTS+T IEW L+ELIRHP+ MK L Sbjct: 260 QRDFVDALLSVVNQSMISHDGAESEIDRSNIKAILIDIIVAAVDTSATAIEWTLAELIRHPQAMKTL 326
BLAST of DY475449 vs. TrEMBL
Match: D7SIX2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00008261001 PE=4 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.505e-12 Identity = 34/65 (52.31%), Postives = 51/65 (78.46%), Query Frame = 3 Query: 60 DFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 +F++++LS+M++ FE++ IDR N KAI+LD++V GID+S T IEW +SEL+RHPRVM+ L Sbjct: 364 NFIDVVLSLMNKSNNFEDDPLYAIDRQNAKAIILDILVGGIDSSITSIEWVISELLRHPRVMRRL 428
BLAST of DY475449 vs. TrEMBL
Match: A5B159_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_033534 PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 2.568e-12 Identity = 33/65 (50.77%), Postives = 52/65 (80.00%), Query Frame = 3 Query: 60 DFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 +F++I+LS+M + +F++E IDRTN+KAI+ D++V GID+S ++WAL+EL+RHPRVMK + Sbjct: 263 NFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIIFDILVGGIDSSLISVDWALAELLRHPRVMKKV 327
BLAST of DY475449 vs. TrEMBL
Match: Q75W19_PANGI (Cytochrome P450 OS=Panax ginseng PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 4.842e-11 Identity = 33/63 (52.38%), Postives = 48/63 (76.19%), Query Frame = 3 Query: 60 DFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMK 248 DF++ +LS+ ++P +E + +IDR+ IKAI++D+I A IDTS T IEW L+ELI+HPR MK Sbjct: 264 DFIDDMLSLKNKPSNTHDELSKVIDRSVIKAIMIDIISAAIDTSDTSIEWILTELIKHPRAMK 326
BLAST of DY475449 vs. TrEMBL
Match: B9RLJ1_RICCO (Flavonoid 3-hydroxylase, putative OS=Ricinus communis GN=RCOM_1467540 PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.079e-10 Identity = 34/70 (48.57%), Postives = 52/70 (74.29%), Query Frame = 3 Query: 54 REDFVNILLSIMHQP---IEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 ++DF++++LS+M++ I + + +IDRT IKAI+ D+IV G +TS++ IEW SEL+RHPRVMK L Sbjct: 273 QKDFIDVMLSVMNRSSPMIPPNDPQSYVIDRTCIKAIIQDIIVGGFETSTSSIEWTFSELLRHPRVMKCL 342
BLAST of DY475449 vs. TrEMBL
Match: B9HFW5_POPTR (Cytochrome P450 OS=Populus trichocarpa GN=CYP736A8v1 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.409e-10 Identity = 36/66 (54.55%), Postives = 48/66 (72.73%), Query Frame = 3 Query: 57 EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 +DFV+++L + E E++ I R NIKAI+LDM+V +DTS+T IEW LSELIRHPRVMK + Sbjct: 264 KDFVDVMLDFLGSE---ETEYS--IGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMKKV 324
BLAST of DY475449 vs. TAIR peptide
Match: AT1G11610.2 (| Symbols: CYP71A18 | cytochrome P450, family 71, subfamily A, polypeptide 18 | chr1:3906983-3909291 REVERSE LENGTH=504) HSP 1 Score: 68.1662 bits (165), Expect = 1.220e-12 Identity = 34/68 (50.00%), Postives = 46/68 (67.65%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 H+ DFVNILLSI E E + + R +IK ++LDM + GI TSST++EW ++ELIR+P MK L Sbjct: 262 HKADFVNILLSI-----EKEKNNGFKVQRNDIKFMILDMFIGGISTSSTLLEWIMTELIRNPECMKKL 324
BLAST of DY475449 vs. TAIR peptide
Match: AT1G11610.1 (| Symbols: CYP71A18 | cytochrome P450, family 71, subfamily A, polypeptide 18 | chr1:3907461-3909291 REVERSE LENGTH=497) HSP 1 Score: 68.1662 bits (165), Expect = 1.220e-12 Identity = 34/68 (50.00%), Postives = 46/68 (67.65%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 H+ DFVNILLSI E E + + R +IK ++LDM + GI TSST++EW ++ELIR+P MK L Sbjct: 262 HKADFVNILLSI-----EKEKNNGFKVQRNDIKFMILDMFIGGISTSSTLLEWIMTELIRNPECMKKL 324
BLAST of DY475449 vs. TAIR peptide
Match: AT2G30750.1 (| Symbols: CYP71A12 | cytochrome P450, family 71, subfamily A, polypeptide 12 | chr2:13099486-13101389 REVERSE LENGTH=503) HSP 1 Score: 65.4698 bits (158), Expect = 7.906e-12 Identity = 34/68 (50.00%), Postives = 45/68 (66.18%), Query Frame = 3 Query: 51 HREDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 H+EDFV+ILLSI E E R +IK ++LDM + G TSST++EW ++ELIR+P VMK L Sbjct: 268 HKEDFVDILLSI-----ESEKSIGFQAQRDDIKFMILDMFIGGTSTSSTLLEWIMTELIRNPNVMKKL 330
BLAST of DY475449 vs. TAIR peptide
Match: AT3G48270.1 (| Symbols: CYP71A26 | cytochrome P450, family 71, subfamily A, polypeptide 26 | chr3:17876571-17878173 FORWARD LENGTH=489) HSP 1 Score: 62.3882 bits (150), Expect = 6.693e-11 Identity = 31/66 (46.97%), Postives = 49/66 (74.24%), Query Frame = 3 Query: 60 DFVNILLSIMH-QPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 DFV++LL+I + + FE I+R +IKAI++++ V G DTSST++EWA++EL+RHP+ +K L Sbjct: 258 DFVDVLLAIQRDKTVGFE------INRVSIKAIVMNVFVGGTDTSSTLMEWAMTELLRHPKCLKRL 317
BLAST of DY475449 vs. TAIR peptide
Match: AT3G26310.1 (| Symbols: CYP71B35 | cytochrome P450, family 71, subfamily B, polypeptide 35 | chr3:9641089-9642779 REVERSE LENGTH=500) HSP 1 Score: 62.003 bits (149), Expect = 8.741e-11 Identity = 31/66 (46.97%), Postives = 47/66 (71.21%), Query Frame = 3 Query: 57 EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 EDFV++LL + + N+ + R +IKAILLD+++AGIDTS+ + WA++EL R+PRVMK + Sbjct: 264 EDFVDLLLRLEKEEAVLGNDK---LTRNHIKAILLDVLLAGIDTSAITMTWAMTELARNPRVMKKV 326
BLAST of DY475449 vs. TAIR peptide
Match: AT3G48300.1 (| Symbols: CYP71A23 | cytochrome P450, family 71, subfamily A, polypeptide 23 | chr3:17885524-17887118 FORWARD LENGTH=483) HSP 1 Score: 61.6178 bits (148), Expect = 1.142e-10 Identity = 30/67 (44.78%), Postives = 43/67 (64.18%), Query Frame = 3 Query: 54 REDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 + DFV++LL+ + IDR +IKAI+LD V G DTSST++EW ++EL+RHP +K L Sbjct: 254 KTDFVDVLLAAQR-----DKSFGFDIDRLSIKAIVLDAFVGGTDTSSTLVEWEMTELLRHPTCLKKL 315
BLAST of DY475449 vs. TAIR peptide
Match: AT2G24180.1 (| Symbols: CYP71B6 | cytochrome p450 71b6 | chr2:10281890-10283589 FORWARD LENGTH=503) HSP 1 Score: 61.6178 bits (148), Expect = 1.142e-10 Identity = 28/67 (41.79%), Postives = 45/67 (67.16%), Query Frame = 3 Query: 54 REDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 RED +++LL + Q + + I T+I+AI++D+ VAG+DTS ++W ++EL RHPRVMK + Sbjct: 270 REDLIDVLLKLQSQETKLGSSR---ITDTHIRAIIMDLFVAGVDTSVITLDWTMAELSRHPRVMKKV 333
BLAST of DY475449 vs. TAIR peptide
Match: AT3G48320.1 (| Symbols: CYP71A21 | cytochrome P450, family 71, subfamily A, polypeptide 21 | chr3:17891241-17892804 FORWARD LENGTH=490) HSP 1 Score: 60.077 bits (144), Expect = 3.322e-10 Identity = 32/68 (47.06%), Postives = 47/68 (69.12%), Query Frame = 3 Query: 54 REDFVNILLSIMHQP-IEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 R DFV++LL I + I FE IDR IKAI+LD++VAG D+S +++WA++EL+RHP ++ L Sbjct: 257 RTDFVDVLLRIQREKSIGFE------IDRLCIKAIVLDVLVAGTDSSYALMDWAMTELLRHPECLRTL 318
BLAST of DY475449 vs. TAIR peptide
Match: AT3G26300.1 (| Symbols: CYP71B34 | cytochrome P450, family 71, subfamily B, polypeptide 34 | chr3:9639199-9640866 REVERSE LENGTH=500) HSP 1 Score: 58.9214 bits (141), Expect = 7.400e-10 Identity = 28/66 (42.42%), Postives = 47/66 (71.21%), Query Frame = 3 Query: 57 EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 EDFV++LL + + N+ + R +IKAIL+D+++AG+DTS+ + WA++EL ++PRVMK + Sbjct: 265 EDFVDLLLRLEKEEAVLGNDK---LTRNHIKAILMDVLLAGMDTSAITMTWAMAELAKNPRVMKKV 327
BLAST of DY475449 vs. TAIR peptide
Match: AT2G30770.1 (| Symbols: CYP71A13 | cytochrome P450, family 71, subfamily A, polypeptide 13 | chr2:13109909-13112006 REVERSE LENGTH=503) HSP 1 Score: 58.151 bits (139), Expect = 1.262e-9 Identity = 29/67 (43.28%), Postives = 43/67 (64.18%), Query Frame = 3 Query: 54 REDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNL 254 + DFV+ILLSI E + + R +IK ++LDM + G T+ST++EW ++ELIR P+ MK L Sbjct: 269 KADFVDILLSI-----EKDKNSGFQVQRNDIKFMILDMFIGGTSTTSTLLEWTMTELIRSPKSMKKL 330 The following BLAST results are available for this feature:
BLAST of DY475449 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 10
BLAST of DY475449 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of DY475449 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY475449 ID=DY475449; Name=DY475449; organism=Cicer arietinum; type=EST; length=255bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|