FE673095
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE673095 vs. TrEMBL
Match: D7T8Q1_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00011708001 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.872e-9 Identity = 35/55 (63.64%), Postives = 41/55 (74.55%), Query Frame = -3 Query: 359 ADKYCKIISGRVSQSNGCKACLTFTVL-ALAVGAAVFYPNMESVGFKKLSVLFYS 520 ADKYCK I GRVS+ +GC LTF V+ A+AVGAA+ PNMES KKLSV+F S Sbjct: 450 ADKYCKGILGRVSRGHGCMKSLTFAVIAAVAVGAALMSPNMESWDLKKLSVVFSS 504
BLAST of FE673095 vs. TrEMBL
Match: A5BH62_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_007906 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.510e-8 Identity = 34/55 (61.82%), Postives = 40/55 (72.73%), Query Frame = -3 Query: 359 ADKYCKIISGRVSQSNGCKACLTFTVL-ALAVGAAVFYPNMESVGFKKLSVLFYS 520 A KYCK I GRVS+ +GC LTF V+ A+AVGAA+ PNMES KKLSV+F S Sbjct: 536 AXKYCKGILGRVSRGHGCMKSLTFAVIAAVAVGAALMSPNMESWDLKKLSVVFSS 590
BLAST of FE673095 vs. TrEMBL
Match: B9SP73_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0629290 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.775e-7 Identity = 31/56 (55.36%), Postives = 39/56 (69.64%), Query Frame = -3 Query: 353 ADKYCKIISGRVSQSNGCKACLTFTVLALAVGAAVFYPNMESVGFKKLSVLFYSQF 520 ADKYCK I G++S+ C +T V+ALAVGAA+ PNMES +KKL+V SQF Sbjct: 533 ADKYCKAILGKLSRGRFCTK-MTVAVVALAVGAAIISPNMESWDWKKLAVFVNSQF 587 The following BLAST results are available for this feature:
BLAST of FE673095 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE673095 ID=FE673095; Name=FE673095; organism=Cicer arietinum; type=EST; length=522bpback to top |