GR391481
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR391481 vs. TrEMBL
Match: C6SXB5_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 2.651e-7 Identity = 32/66 (48.48%), Postives = 37/66 (56.06%), Query Frame = -3 Query: 75 VNFGGRGFTVKRAGAIFTAFNENFAGIRTVSVNYRTCPTFTRLAERG----TQGQAIACMFSSDFP 260 + F G F + GAIFT FNENFA IR +S +Y CPTFT LAE Q Q C + DFP Sbjct: 63 IQFLGHCFALNGTGAIFTTFNENFASIRPLSFSYDACPTFTHLAECAALGHVQAQGFICFW--DFP 126
BLAST of GR391481 vs. TrEMBL
Match: D7TTW4_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_12.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00013151001 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 4.522e-7 Identity = 26/56 (46.43%), Postives = 32/56 (57.14%), Query Frame = 3 Query: 78 KVRAEHTSYGL---ALGTAFC*TGKGWTCAIINTDGPDAGKVFVKCGENCTCPLNG 236 K + +Y L G A C G+G+TC I GPDAGK FV+CG CTC +NG Sbjct: 65 KTEGDSKTYALKSPGAGMAICRVGEGYTCVITKITGPDAGKTFVECGGGCTCVING 120 The following BLAST results are available for this feature:
BLAST of GR391481 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR391481 ID=GR391481; Name=GR391481; organism=Cicer arietinum; type=EST; length=565bpback to top |