GR395830
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR395830 vs. TrEMBL
Match: B9IJR3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_835680 PE=4 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 6.765e-13 Identity = 35/42 (83.33%), Postives = 37/42 (88.10%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NGTDPC GNTTVLRPG G+KRLET+IS LLSNENFRPRQC Sbjct: 386 NGTDPCSAIGNTTVLRPGPGAKRLETMISTLLSNENFRPRQC 427
BLAST of GR395830 vs. TrEMBL
Match: B9H3Y7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_556242 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.727e-12 Identity = 33/42 (78.57%), Postives = 37/42 (88.10%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NGTDPC GNTTVLRPG G+KRL++LIS LLSNENF+PRQC Sbjct: 386 NGTDPCSAIGNTTVLRPGPGAKRLQSLISSLLSNENFQPRQC 427
BLAST of GR395830 vs. TrEMBL
Match: B9RUK1_RICCO (Acetylglucosaminyltransferase, putative OS=Ricinus communis GN=RCOM_0853740 PE=4 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.769e-12 Identity = 33/42 (78.57%), Postives = 37/42 (88.10%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NG+DPC V GNTTVLRPG G+KRLE LIS LLS+ENFRP+QC Sbjct: 388 NGSDPCSVIGNTTVLRPGPGAKRLENLISNLLSSENFRPKQC 429
BLAST of GR395830 vs. TrEMBL
Match: B6SUI5_MAIZE (BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein OS=Zea mays PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.001e-10 Identity = 29/48 (60.42%), Postives = 36/48 (75.00%), Query Frame = -1 Query: 238 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQCV*DEPN 381 NGTDPC G+ VLRPG G++RL+ L++ LLS ENFRPRQCV + N Sbjct: 408 NGTDPCAAVGDAAVLRPGPGAERLQRLVTSLLSEENFRPRQCVVENEN 455
BLAST of GR395830 vs. TrEMBL
Match: Q9LFQ0_ARATH (AT5g15050/F2G14_170 OS=Arabidopsis thaliana GN=F2G14_170 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.037e-9 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NG+DPC V G+T+V++PG G+KR+E LI+ LLS ENFRPRQC Sbjct: 392 NGSDPCAVIGDTSVIKPGLGAKRIEKLITYLLSTENFRPRQC 433
BLAST of GR395830 vs. TrEMBL
Match: A5AKF8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_030959 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.475e-9 Identity = 28/42 (66.67%), Postives = 33/42 (78.57%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NGTDPC V GN +VL+PG G+KRL L+ LLS +NFRPRQC Sbjct: 362 NGTDPCXVVGNPSVLKPGPGAKRLXNLLVSLLSKQNFRPRQC 403
BLAST of GR395830 vs. TrEMBL
Match: D7M6Q9_ARALY (Glycosyltransferase family 14 protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_488347 PE=4 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 5.927e-9 Identity = 27/42 (64.29%), Postives = 36/42 (85.71%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NG+DPC + G+T+V++PG G+KR+E LI+ LLS ENFRPRQC Sbjct: 392 NGSDPCAMIGDTSVIKPGLGAKRVEKLITYLLSTENFRPRQC 433
BLAST of GR395830 vs. TrEMBL
Match: Q9FLD7_ARATH (At5g39990 OS=Arabidopsis thaliana GN=At5g39990 PE=2 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.724e-8 Identity = 26/42 (61.90%), Postives = 34/42 (80.95%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NG+DPC V G+T V+RPG G++RLE L++ LLS ENFR +QC Sbjct: 405 NGSDPCAVIGDTDVIRPGPGARRLENLVTSLLSTENFRSKQC 446
BLAST of GR395830 vs. TrEMBL
Match: D7MJE1_ARALY (Glycosyltransferase family 14 protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_493988 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.252e-8 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NG+DPC V G T V+RPG G++RLE L++ LLS ENFR +QC Sbjct: 403 NGSDPCAVIGETDVIRPGPGARRLENLVTSLLSTENFRSKQC 444
BLAST of GR395830 vs. TrEMBL
Match: C5WPH6_SORBI (Putative uncharacterized protein Sb01g011480 OS=Sorghum bicolor GN=Sb01g011480 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.017e-8 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = -1 Query: 253 NGTD--PCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQCV 381 NGTD PC GN LRPG G++RL+ L++ LLS ENFRPRQCV Sbjct: 408 NGTDDDPCAAVGNAAFLRPGPGAERLQRLVTSLLSEENFRPRQCV 452
BLAST of GR395830 vs. TAIR peptide
Match: AT5G15050.1 (| Symbols: | Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein | chr5:4871820-4873454 REVERSE LENGTH=434) HSP 1 Score: 65.4698 bits (158), Expect = 9.642e-12 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NG+DPC V G+T+V++PG G+KR+E LI+ LLS ENFRPRQC Sbjct: 392 NGSDPCAVIGDTSVIKPGLGAKRIEKLITYLLSTENFRPRQC 433
BLAST of GR395830 vs. TAIR peptide
Match: AT5G39990.1 (| Symbols: | Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein | chr5:16004494-16006428 FORWARD LENGTH=447) HSP 1 Score: 62.3882 bits (150), Expect = 8.163e-11 Identity = 26/42 (61.90%), Postives = 34/42 (80.95%), Query Frame = -1 Query: 256 NGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQC 381 NG+DPC V G+T V+RPG G++RLE L++ LLS ENFR +QC Sbjct: 405 NGSDPCAVIGDTDVIRPGPGARRLENLVTSLLSTENFRSKQC 446 The following BLAST results are available for this feature:
BLAST of GR395830 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR395830 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR395830 ID=GR395830; Name=GR395830; organism=Cicer arietinum; type=EST; length=381bpback to top |