HO063005
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO063005 vs. TAIR peptide
Match: AT5G54940.2 (| Symbols: | Translation initiation factor SUI1 family protein | chr5:22308420-22308758 REVERSE LENGTH=112) HSP 1 Score: 54.6842 bits (130), Expect = 1.387e-8 Identity = 35/78 (44.87%), Postives = 47/78 (60.26%), Query Frame = -2 Query: 60 RGREKRLDSSSGGKKEFSWGRFSK-ISERVLCTGNFFREKELGKIIQLQGGSGVRTFSQFLFQVGPGEERARIKIQGF 290 R +K L + G KKE+S+ R K + + C GN ++KELGKIIQLQG + SQFL Q G ++ +IKI GF Sbjct: 37 RNGKKSLTTVQGLKKEYSYERILKDLKKDFCCNGNVVQDKELGKIIQLQGDQR-KKVSQFLVQTGIA-KKDQIKIHGF 112
BLAST of HO063005 vs. TAIR peptide
Match: AT5G54940.1 (| Symbols: | Translation initiation factor SUI1 family protein | chr5:22308420-22308758 REVERSE LENGTH=112) HSP 1 Score: 54.6842 bits (130), Expect = 1.387e-8 Identity = 35/78 (44.87%), Postives = 47/78 (60.26%), Query Frame = -2 Query: 60 RGREKRLDSSSGGKKEFSWGRFSK-ISERVLCTGNFFREKELGKIIQLQGGSGVRTFSQFLFQVGPGEERARIKIQGF 290 R +K L + G KKE+S+ R K + + C GN ++KELGKIIQLQG + SQFL Q G ++ +IKI GF Sbjct: 37 RNGKKSLTTVQGLKKEYSYERILKDLKKDFCCNGNVVQDKELGKIIQLQGDQR-KKVSQFLVQTGIA-KKDQIKIHGF 112 The following BLAST results are available for this feature:
BLAST of HO063005 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO063005 ID=HO063005; Name=HO063005; organism=Cicer arietinum; type=EST; length=300bpback to top |