CK149047
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK149047 vs. TrEMBL
Match: D3YBE9_TRIRP (Zinc knuckle (CcHc-type) family protein OS=Trifolium repens PE=4 SV=1) HSP 1 Score: 131.724 bits (330), Expect = 2.956e-29 Identity = 56/59 (94.92%), Postives = 59/59 (100.00%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 PG+RKIRSDRFS+RDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPG+ Sbjct: 16 PGIRKIRSDRFSYRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGH 74
BLAST of CK149047 vs. TrEMBL
Match: C6TNV0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 123.635 bits (309), Expect = 8.051e-27 Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P RKIRSDRFS+RDAPYRRDS RGFSRDNLCKNCKRPGHYARECPNVA+CHNCGLPG+ Sbjct: 14 PMDRKIRSDRFSYRDAPYRRDSRRGFSRDNLCKNCKRPGHYARECPNVAICHNCGLPGH 72
BLAST of CK149047 vs. TrEMBL
Match: C6T6L3_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1) HSP 1 Score: 123.635 bits (309), Expect = 8.051e-27 Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P RKIRSDRFS+RDAPYRRDS RGFSRDNLCKNCKRPGHYARECPNVA+CHNCGLPG+ Sbjct: 14 PMDRKIRSDRFSYRDAPYRRDSRRGFSRDNLCKNCKRPGHYARECPNVAICHNCGLPGH 72
BLAST of CK149047 vs. TrEMBL
Match: B9RHD0_RICCO (Cellular nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_1450080 PE=4 SV=1) HSP 1 Score: 114.39 bits (285), Expect = 4.884e-24 Identity = 48/59 (81.36%), Postives = 55/59 (93.22%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P RKIRSDRFS+R APYRR+S RGFS++NLCKNCKRPGH+ARECPNVA+CHNCGLPG+ Sbjct: 20 PMDRKIRSDRFSYRGAPYRRESRRGFSQNNLCKNCKRPGHFARECPNVAICHNCGLPGH 78
BLAST of CK149047 vs. TrEMBL
Match: D3YBF0_TRIRP (Zinc knuckle (CcHc-type) family protein OS=Trifolium repens PE=4 SV=1) HSP 1 Score: 114.005 bits (284), Expect = 6.379e-24 Identity = 48/59 (81.36%), Postives = 53/59 (89.83%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P R+ RS+RFS RDAPYRRDS RGFS+DNLCKNCKRPGHYARECPN+AVCHNC LPG+ Sbjct: 20 PMDRRFRSERFSHRDAPYRRDSRRGFSQDNLCKNCKRPGHYARECPNIAVCHNCSLPGH 78
BLAST of CK149047 vs. TrEMBL
Match: D7U5H5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_38.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00024180001 PE=4 SV=1) HSP 1 Score: 112.464 bits (280), Expect = 1.856e-23 Identity = 48/59 (81.36%), Postives = 53/59 (89.83%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P RKIR+DR S+R+APYRRDS RGFS+ NLCKNCKRPGHYARECPNVAVCHNC LPG+ Sbjct: 12 PQDRKIRTDRLSYRNAPYRRDSRRGFSQGNLCKNCKRPGHYARECPNVAVCHNCSLPGH 70
BLAST of CK149047 vs. TrEMBL
Match: B9H0X4_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_195673 PE=4 SV=1) HSP 1 Score: 107.071 bits (266), Expect = 7.798e-22 Identity = 47/61 (77.05%), Postives = 53/61 (86.89%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRG--FSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P R+IRSDRFS+R APYRR+S RG F + NLCKNCKRPGHYARECPNVA+CHNCGLPG+ Sbjct: 6 PMDRRIRSDRFSYRGAPYRRESRRGYRFLQSNLCKNCKRPGHYARECPNVAICHNCGLPGH 66
BLAST of CK149047 vs. TrEMBL
Match: B9R835_RICCO (Cellular nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_1596490 PE=4 SV=1) HSP 1 Score: 102.064 bits (253), Expect = 2.508e-20 Identity = 43/59 (72.88%), Postives = 52/59 (88.14%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P R+IRS R S+RDAPYRR++ RGFS+ +LC NCKRPGH+ARECPNVAVC+NCGLPG+ Sbjct: 22 PRDRRIRSRRNSYRDAPYRRETRRGFSQSSLCNNCKRPGHFARECPNVAVCNNCGLPGH 80
BLAST of CK149047 vs. TrEMBL
Match: Q9AV38_ORYSJ (Os10g0545300 protein OS=Oryza sativa subsp. japonica GN=OSJNBa0001O14.4 PE=2 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 1.798e-18 Identity = 42/61 (68.85%), Postives = 52/61 (85.25%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSR--DNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P R+IR++R S+RDAPYRRDS RG SR ++LC NCKRPGH+AR+CPNVA+CH CGLPG+ Sbjct: 8 PKDRRIRTERTSYRDAPYRRDSRRGPSRFPNDLCNNCKRPGHFARDCPNVALCHACGLPGH 68
BLAST of CK149047 vs. TrEMBL
Match: A2Z9X0_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_34532 PE=4 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 1.798e-18 Identity = 42/61 (68.85%), Postives = 52/61 (85.25%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSSRGFSR--DNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P R+IR++R S+RDAPYRRDS RG SR ++LC NCKRPGH+AR+CPNVA+CH CGLPG+ Sbjct: 8 PKDRRIRTERTSYRDAPYRRDSRRGPSRFPNDLCNNCKRPGHFARDCPNVALCHACGLPGH 68
BLAST of CK149047 vs. TAIR peptide
Match: AT1G75560.2 (| Symbols: | zinc knuckle (CCHC-type) family protein | chr1:28371420-28372717 REVERSE LENGTH=257) HSP 1 Score: 86.2705 bits (212), Expect = 1.156e-17 Identity = 37/61 (60.66%), Postives = 48/61 (78.69%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSS--RGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P R++RS+R S+ DAP RR+ R FS+ NLC NCKRPGH+AR+C NV+VC+NCGLPG+ Sbjct: 24 PRDRRMRSERVSYHDAPSRREREPRRAFSQGNLCNNCKRPGHFARDCSNVSVCNNCGLPGH 84
BLAST of CK149047 vs. TAIR peptide
Match: AT1G75560.1 (| Symbols: | zinc knuckle (CCHC-type) family protein | chr1:28371420-28372717 REVERSE LENGTH=257) HSP 1 Score: 86.2705 bits (212), Expect = 1.156e-17 Identity = 37/61 (60.66%), Postives = 48/61 (78.69%), Query Frame = 2 Query: 239 PGVRKIRSDRFSFRDAPYRRDSS--RGFSRDNLCKNCKRPGHYARECPNVAVCHNCGLPGY 415 P R++RS+R S+ DAP RR+ R FS+ NLC NCKRPGH+AR+C NV+VC+NCGLPG+ Sbjct: 24 PRDRRMRSERVSYHDAPSRREREPRRAFSQGNLCNNCKRPGHFARDCSNVSVCNNCGLPGH 84 The following BLAST results are available for this feature:
BLAST of CK149047 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of CK149047 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK149047 ID=CK149047; Name=CK149047; organism=Cicer arietinum; type=EST; length=544bpback to top |