GR400492
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR400492 vs. TrEMBL
Match: C7YSJ5_NECH7 (Putative uncharacterized protein OS=Nectria haematococca (strain 77-13-4 / FGSC 9596 / MPVI) GN=NECHADRAFT_73723 PE=4 SV=1) HSP 1 Score: 110.153 bits (274), Expect = 7.057e-23 Identity = 45/58 (77.59%), Postives = 48/58 (82.76%), Query Frame = 1 Query: 61 KGCKPGTYSCTPDKTGWQVCDVNGKYVAAGVCPPKTSCVFYKPSGSPYCVPPGFKFPK 234 KGC PGTYSCT D GWQVCDV +V AG+CPPKT CVFYKPS SPYCVPPGFKFP+ Sbjct: 21 KGCTPGTYSCTGDLKGWQVCDVTRNWVFAGICPPKTGCVFYKPSNSPYCVPPGFKFPQ 78
BLAST of GR400492 vs. TrEMBL
Match: D1Z4M5_SORMA (Whole genome shotgun sequence assembly, scaffold_4 OS=Sordaria macrospora GN=SMAC_01295 PE=4 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.069e-13 Identity = 33/62 (53.23%), Postives = 41/62 (66.13%), Query Frame = 1 Query: 40 TPLDASTKGCKPGTYSCTPDKT----GWQVCDVNGKYVAAGVCPPKTSCVFYKPSGSPYCVP 213 TP + CKP TY+C + + GWQVCDV K+V AG CPPKTSC F + +GSPYC+P Sbjct: 17 TPTGTNPPQCKPATYACAKNPSTHAEGWQVCDVTSKWVYAGDCPPKTSCQFLEANGSPYCIP 78
BLAST of GR400492 vs. TrEMBL
Match: Q7SI44_NEUCR (Predicted protein OS=Neurospora crassa GN=B22I21.030 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.631e-11 Identity = 31/62 (50.00%), Postives = 39/62 (62.90%), Query Frame = 1 Query: 40 TPLDASTKGCKPGTYSCTPDKT----GWQVCDVNGKYVAAGVCPPKTSCVFYKPSGSPYCVP 213 +P + C P TYSC + GWQVCDV+ K+V AG CPPKT C F + +GSPYC+P Sbjct: 17 SPTGTNPPQCTPATYSCAKNPNTHAEGWQVCDVDSKWVYAGDCPPKTVCKFLEANGSPYCIP 78
BLAST of GR400492 vs. TrEMBL
Match: Q2H549_CHAGB (Predicted protein OS=Chaetomium globosum GN=CHGG_06216 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.183e-7 Identity = 24/50 (48.00%), Postives = 29/50 (58.00%), Query Frame = 1 Query: 64 GCKPGTYSCTPDKTGWQVCDVNGKYVAAGVCPPKTSCVFYKPSGSPYCVP 213 GC+PG YSCT GW+VC +G +V AG C C + SPYCVP Sbjct: 69 GCRPGAYSCTTTGNGWRVCGASGHWVYAGYCGWNQHCQMNWQNQSPYCVP 118 The following BLAST results are available for this feature:
BLAST of GR400492 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR400492 ID=GR400492; Name=GR400492; organism=Cicer arietinum; type=EST; length=477bpback to top |