HO066333
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO066333 vs. TrEMBL
Match: A9PFZ5_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.986e-8 Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLARSGNK+QEVIVQ SL KE MKS +++C NRVE Sbjct: 368 QYKLLARSGNKVQEVIVQASLSKEEMKSTILSCTNRVE 405
BLAST of HO066333 vs. TrEMBL
Match: D7TW34_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_25.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00019806001 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.512e-8 Identity = 28/37 (75.68%), Postives = 33/37 (89.19%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRV 127 +YKLLARSGNK+QEVIV+ SL KE MKSA++TC NRV Sbjct: 671 QYKLLARSGNKVQEVIVEASLGKEDMKSAILTCTNRV 707
BLAST of HO066333 vs. TrEMBL
Match: B9RC83_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1686120 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 1.895e-7 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLARSGNK+QEVIV+ SLDKE MKS +++C RVE Sbjct: 711 QYKLLARSGNKVQEVIVEASLDKEEMKSTILSCTYRVE 748
BLAST of HO066333 vs. TrEMBL
Match: Q9LPW9_ARATH (F13K23.5 protein OS=Arabidopsis thaliana GN=F13K23.5 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.513e-7 Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLAR+GN++QE+IV+ SL KE MKS +M+C NRVE Sbjct: 738 QYKLLARAGNRVQELIVEASLSKEEMKSTIMSCTNRVE 775
BLAST of HO066333 vs. TrEMBL
Match: Q94AJ9_ARATH (Putative heat shock factor protein hsf8 OS=Arabidopsis thaliana GN=At1g12800 PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.513e-7 Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLAR+GN++QE+IV+ SL KE MKS +M+C NRVE Sbjct: 730 QYKLLARAGNRVQELIVEASLSKEEMKSTIMSCTNRVE 767
BLAST of HO066333 vs. TrEMBL
Match: Q570M2_ARATH (Putative uncharacterized protein At1g12800 (Fragment) OS=Arabidopsis thaliana GN=At1g12800 PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.513e-7 Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLAR+GN++QE+IV+ SL KE MKS +M+C NRVE Sbjct: 60 QYKLLARAGNRVQELIVEASLSKEEMKSTIMSCTNRVE 97
BLAST of HO066333 vs. TrEMBL
Match: D7KPD0_ARALY (S1 RNA-binding domain-containing protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_888630 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.513e-7 Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLAR+GN++QE+IV+ SL KE MKS +M+C NRVE Sbjct: 731 QYKLLARAGNRVQELIVEASLSKEEMKSTIMSCTNRVE 768
BLAST of HO066333 vs. TrEMBL
Match: B9DI42_ARATH (AT1G12800 protein (Fragment) OS=Arabidopsis thaliana GN=AT1G12800 PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.513e-7 Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLAR+GN++QE+IV+ SL KE MKS +M+C NRVE Sbjct: 488 QYKLLARAGNRVQELIVEASLSKEEMKSTIMSCTNRVE 525
BLAST of HO066333 vs. TAIR peptide
Match: AT1G12800.1 (| Symbols: | Nucleic acid-binding, OB-fold-like protein | chr1:4361778-4365189 REVERSE LENGTH=767) HSP 1 Score: 57.3806 bits (137), Expect = 4.654e-9 Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 17 RYKLLARSGNKIQEVIVQTSLDKETMKSALMTCANRVE 130 +YKLLAR+GN++QE+IV+ SL KE MKS +M+C NRVE Sbjct: 730 QYKLLARAGNRVQELIVEASLSKEEMKSTIMSCTNRVE 767 The following BLAST results are available for this feature:
BLAST of HO066333 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 8
BLAST of HO066333 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO066333 ID=HO066333; Name=HO066333; organism=Cicer arietinum; type=EST; length=488bpback to top |