FE670052
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE670052 vs. TrEMBL
Match: C6SWN8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.494e-9 Identity = 29/44 (65.91%), Postives = 32/44 (72.73%), Query Frame = 2 Query: 188 MANPQEHGRPWFLYAVPLMVFLLIAFHVLALVYWIYRLSTDTKP 319 MA P+ PW AVPL+V LLIA HV ALVYWIYRL+TD KP Sbjct: 1 MAKPESQEHPWISNAVPLLVVLLIALHVFALVYWIYRLATDNKP 44
BLAST of FE670052 vs. TAIR peptide
Match: AT5G10745.1 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G24980.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr5:3396553-3396795 FORWARD LENGTH=51) HSP 1 Score: 55.0694 bits (131), Expect = 1.854e-8 Identity = 24/39 (61.54%), Postives = 30/39 (76.92%), Query Frame = 2 Query: 200 QEHGRPWFLYAVPLMVFLLIAFHVLALVYWIYRLSTDTK 316 ++H RPWFL VP +V LL A HV+AL YWIYRL+TD + Sbjct: 4 EQHLRPWFLDLVPALVVLLAAAHVIALGYWIYRLATDRR 42 The following BLAST results are available for this feature:
BLAST of FE670052 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of FE670052 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE670052 ID=FE670052; Name=FE670052; organism=Cicer arietinum; type=EST; length=444bpback to top |