GR399722
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR399722 vs. TrEMBL
Match: B9RRN3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1648660 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.474e-10 Identity = 31/41 (75.61%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 37 RWVHESDEVALTTEPCLSVGVNWMIGPRAAPSSPHSPFPKI 159 RWV ES EVAL TEPCL VG NWMIGPR S PHSPFP I Sbjct: 12 RWVDESAEVALPTEPCLPVGANWMIGPRTGLSFPHSPFPNI 52
BLAST of GR399722 vs. TrEMBL
Match: Q0MX20_ARAHY (Serine rich protein OS=Arachis hypogaea PE=2 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 5.158e-8 Identity = 37/68 (54.41%), Postives = 42/68 (61.76%), Query Frame = -2 Query: 259 MYLSSAVV*LTISPFHVWE*NQFTGRIALPIKSFFPGSF-NLVDYDNSRDYKQTRNYGRAVRSALSRP 459 M LSSA+V T SP VW QFTGRIALPI+SFFPGSF + DYKQTR Y + L+ P Sbjct: 1 MVLSSALVYSTCSPVSVWGTVQFTGRIALPIRSFFPGSFPPCYLWTTVADYKQTRYYWGGRGTPLASP 68
BLAST of GR399722 vs. TrEMBL
Match: B9RPV9_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1542210 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 6.616e-8 Identity = 28/31 (90.32%), Postives = 30/31 (96.77%), Query Frame = -3 Query: 12 QFTPTDRHGSVVKATSSLSCTHRTAALSGLP 104 QFTPTDRHGSVVKATSSLSCT+RT ALSG+P Sbjct: 57 QFTPTDRHGSVVKATSSLSCTYRTIALSGVP 87 The following BLAST results are available for this feature:
BLAST of GR399722 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR399722 ID=GR399722; Name=GR399722; organism=Cicer arietinum; type=EST; length=556bpback to top |